Recombinant Human DLST protein(151-220 aa), C-His-tagged
Cat.No. : | DLST-2743H |
Product Overview : | Recombinant Human DLST protein(P36957)(151-220 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 151-220 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 9.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | AKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLR |
Gene Name | DLST dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) [ Homo sapiens ] |
Official Symbol | DLST |
Synonyms | DLST; dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex); DLTS; dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial; E2K; OGDC-E2; |
Gene ID | 1743 |
mRNA Refseq | NM_001244883 |
Protein Refseq | NP_001231812 |
MIM | 126063 |
UniProt ID | P36957 |
◆ Recombinant Proteins | ||
DLST-952H | Recombinant Human DLST Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DLST-2688H | Recombinant Human DLST Protein, GST-tagged | +Inquiry |
DLST-1032H | Recombinant Human DLST protein(Asp68-Leu453), His-tagged | +Inquiry |
DLST-2215H | Recombinant Human DLST Protein, MYC/DDK-tagged | +Inquiry |
DLST-11533Z | Recombinant Zebrafish DLST | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLST-485HCL | Recombinant Human DLST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DLST Products
Required fields are marked with *
My Review for All DLST Products
Required fields are marked with *
0
Inquiry Basket