Recombinant Human DLST protein(151-220 aa), C-His-tagged
| Cat.No. : | DLST-2743H |
| Product Overview : | Recombinant Human DLST protein(P36957)(151-220 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 151-220 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 9.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | AKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLR |
| Gene Name | DLST dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) [ Homo sapiens ] |
| Official Symbol | DLST |
| Synonyms | DLST; dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex); DLTS; dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial; E2K; OGDC-E2; |
| Gene ID | 1743 |
| mRNA Refseq | NM_001244883 |
| Protein Refseq | NP_001231812 |
| MIM | 126063 |
| UniProt ID | P36957 |
| ◆ Recombinant Proteins | ||
| DLST-3998HF | Recombinant Full Length Human DLST Protein, GST-tagged | +Inquiry |
| DLST-1280R | Recombinant Rhesus monkey DLST Protein, His-tagged | +Inquiry |
| DLST-1105R | Recombinant Rhesus Macaque DLST Protein, His (Fc)-Avi-tagged | +Inquiry |
| Dlst-4256R | Recombinant Rat Dlst protein, His&Myc-tagged | +Inquiry |
| DLST-2743H | Recombinant Human DLST protein(151-220 aa), C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DLST-485HCL | Recombinant Human DLST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLST Products
Required fields are marked with *
My Review for All DLST Products
Required fields are marked with *
