Recombinant Rat Dlst protein, His&Myc-tagged
| Cat.No. : | Dlst-4256R |
| Product Overview : | Recombinant Rat Dlst protein(Q01205)(69-454aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 69-454aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.9 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | NDVITVQTPAFAESVTEGDVRWEKAVGDAVAEDEVVCEIETDKTSVQVPSPANGIIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPATAYKAAPEAPAAPPPPVAPVPTQMPPVPSPSQPPSSKPVSAIKPTAAPPLAEAGAAKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTINELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAVGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL |
| Gene Name | Dlst dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) [ Rattus norvegicus ] |
| Official Symbol | Dlst |
| Synonyms | DLST; dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex); dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial; E2; E2K; OGDC-E2; 2-oxoglutarate dehydrogenase complex component E2; dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex; MGC95077; |
| Gene ID | 299201 |
| mRNA Refseq | NM_001006981 |
| Protein Refseq | NP_001006982 |
| ◆ Recombinant Proteins | ||
| DLST-1105R | Recombinant Rhesus Macaque DLST Protein, His (Fc)-Avi-tagged | +Inquiry |
| DLST-1280R | Recombinant Rhesus monkey DLST Protein, His-tagged | +Inquiry |
| DLST-3998HF | Recombinant Full Length Human DLST Protein, GST-tagged | +Inquiry |
| DLST-952H | Recombinant Human DLST Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DLST-897H | Recombinant Human DLST protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DLST-485HCL | Recombinant Human DLST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Dlst Products
Required fields are marked with *
My Review for All Dlst Products
Required fields are marked with *
