Recombinant Rat Dlst protein, His&Myc-tagged
Cat.No. : | Dlst-4256R |
Product Overview : | Recombinant Rat Dlst protein(Q01205)(69-454aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 69-454aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | NDVITVQTPAFAESVTEGDVRWEKAVGDAVAEDEVVCEIETDKTSVQVPSPANGIIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPATAYKAAPEAPAAPPPPVAPVPTQMPPVPSPSQPPSSKPVSAIKPTAAPPLAEAGAAKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTINELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAVGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL |
Gene Name | Dlst dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) [ Rattus norvegicus ] |
Official Symbol | Dlst |
Synonyms | DLST; dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex); dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial; E2; E2K; OGDC-E2; 2-oxoglutarate dehydrogenase complex component E2; dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex; MGC95077; |
Gene ID | 299201 |
mRNA Refseq | NM_001006981 |
Protein Refseq | NP_001006982 |
◆ Recombinant Proteins | ||
DLST-2116C | Recombinant Chicken DLST | +Inquiry |
DLST-2403M | Recombinant Mouse DLST Protein, His (Fc)-Avi-tagged | +Inquiry |
DLST-896H | Recombinant Human DLST protein, GST-tagged | +Inquiry |
Dlst-4256R | Recombinant Rat Dlst protein, His&Myc-tagged | +Inquiry |
DLST-1032H | Recombinant Human DLST protein(Asp68-Leu453), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLST-485HCL | Recombinant Human DLST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Dlst Products
Required fields are marked with *
My Review for All Dlst Products
Required fields are marked with *
0
Inquiry Basket