Recombinant Human DLST protein, GST-tagged
| Cat.No. : | DLST-896H |
| Product Overview : | Recombinant Human DLST protein(212-366 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 212-366 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | EPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDG |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | DLST dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) [ Homo sapiens ] |
| Official Symbol | DLST |
| Synonyms | DLST; dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex); DLTS; dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial; E2K; OGDC-E2; |
| mRNA Refseq | NM_001244883 |
| Protein Refseq | NP_001231812 |
| MIM | 126063 |
| UniProt ID | P36957 |
| Gene ID | 1743 |
| ◆ Recombinant Proteins | ||
| DLST-2743H | Recombinant Human DLST protein(151-220 aa), C-His-tagged | +Inquiry |
| DLST-952H | Recombinant Human DLST Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DLST-2688H | Recombinant Human DLST Protein, GST-tagged | +Inquiry |
| DLST-11533Z | Recombinant Zebrafish DLST | +Inquiry |
| DLST-2116C | Recombinant Chicken DLST | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DLST-485HCL | Recombinant Human DLST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLST Products
Required fields are marked with *
My Review for All DLST Products
Required fields are marked with *
