Recombinant Human DLX4 Protein, GST-tagged
| Cat.No. : | DLX4-2694H |
| Product Overview : | Human DLX4 full-length ORF ( NP_612138.1, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. Three transcript variants have been described for this gene, however, the full length nature of one variant has not been described. Studies of the two splice variants revealed that one encoded isoform functions as a repressor of the beta-globin gene while the other isoform lacks that function. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 52.7 kDa |
| AA Sequence : | MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DLX4 distal-less homeobox 4 [ Homo sapiens ] |
| Official Symbol | DLX4 |
| Synonyms | DLX4; distal-less homeobox 4; DLX7, DLX9; homeobox protein DLX-4; BP1; DLX8; beta protein 1; homeobox protein DLX-7; homeobox protein DLX-8; distal-less homeo box 7; distal-less homeo box 9; DLX7; DLX9; |
| Gene ID | 1748 |
| mRNA Refseq | NM_001934 |
| Protein Refseq | NP_001925 |
| MIM | 601911 |
| UniProt ID | Q92988 |
| ◆ Recombinant Proteins | ||
| DLX4-2406M | Recombinant Mouse DLX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DLX4-4637M | Recombinant Mouse DLX4 Protein | +Inquiry |
| DLX4-068H | Recombinant Human DLX4 Protein, HIS-tagged | +Inquiry |
| DLX4-2694H | Recombinant Human DLX4 Protein, GST-tagged | +Inquiry |
| DLX4-4006HF | Recombinant Full Length Human DLX4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DLX4-6904HCL | Recombinant Human DLX4 293 Cell Lysate | +Inquiry |
| DLX4-6905HCL | Recombinant Human DLX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLX4 Products
Required fields are marked with *
My Review for All DLX4 Products
Required fields are marked with *
