Recombinant Human DMBX1 Protein, GST-tagged

Cat.No. : DMBX1-2701H
Product Overview : Human DMBX1 full-length ORF ( NP_757379.1, 1 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 67.1 kDa
AA Sequence : MQHYGVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLADIILEARYGSQHRKQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQKEQLQKQKEAEGSHGEGKAEAPTPDTQLDTEQPPRLPGSDPPAELHLSLSEQSASESAPEDQPDREEDPRAGAEDPKAEKSPGADSKGLGCKRGSPKADSPGSLTITPVAPGGGLLGPSHSYSSSPLSLFRLQEQFRQHMAATNNLVHYSSFEVGGPAPAAAAAAAAVPYLGVNMAPLGSLHCQSYYQSLSAAAAAHQGVWGSPLLPAPPAGLAPASATLNSKTTSIENLRLRAKQHAASLGLDTLPN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DMBX1 diencephalon/mesencephalon homeobox 1 [ Homo sapiens ]
Official Symbol DMBX1
Synonyms DMBX1; diencephalon/mesencephalon homeobox 1; orthodenticle homolog 3 (Drosophila) , OTX3; diencephalon/mesencephalon homeobox protein 1; PAXB; homeoprotein MBX; orthodenticle homolog 3; paired-like homeobox protein DMBX1; MBX; OTX3;
Gene ID 127343
mRNA Refseq NM_147192
Protein Refseq NP_671725
MIM 607410
UniProt ID Q8NFW5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DMBX1 Products

Required fields are marked with *

My Review for All DMBX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon