Recombinant Human DMBX1 Protein, GST-tagged
Cat.No. : | DMBX1-2701H |
Product Overview : | Human DMBX1 full-length ORF ( NP_757379.1, 1 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 67.1 kDa |
AA Sequence : | MQHYGVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLADIILEARYGSQHRKQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQKEQLQKQKEAEGSHGEGKAEAPTPDTQLDTEQPPRLPGSDPPAELHLSLSEQSASESAPEDQPDREEDPRAGAEDPKAEKSPGADSKGLGCKRGSPKADSPGSLTITPVAPGGGLLGPSHSYSSSPLSLFRLQEQFRQHMAATNNLVHYSSFEVGGPAPAAAAAAAAVPYLGVNMAPLGSLHCQSYYQSLSAAAAAHQGVWGSPLLPAPPAGLAPASATLNSKTTSIENLRLRAKQHAASLGLDTLPN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DMBX1 diencephalon/mesencephalon homeobox 1 [ Homo sapiens ] |
Official Symbol | DMBX1 |
Synonyms | DMBX1; diencephalon/mesencephalon homeobox 1; orthodenticle homolog 3 (Drosophila) , OTX3; diencephalon/mesencephalon homeobox protein 1; PAXB; homeoprotein MBX; orthodenticle homolog 3; paired-like homeobox protein DMBX1; MBX; OTX3; |
Gene ID | 127343 |
mRNA Refseq | NM_147192 |
Protein Refseq | NP_671725 |
MIM | 607410 |
UniProt ID | Q8NFW5 |
◆ Recombinant Proteins | ||
DMBX1-4012HF | Recombinant Full Length Human DMBX1 Protein, GST-tagged | +Inquiry |
DMBX1-2701H | Recombinant Human DMBX1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DMBX1-487HCL | Recombinant Human DMBX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DMBX1 Products
Required fields are marked with *
My Review for All DMBX1 Products
Required fields are marked with *