Recombinant Human DMRT1
Cat.No. : | DMRT1-27093TH |
Product Overview : | Recombinant full length Human DMRT1 with N terminal proprietary tag; Predicted MWt 67.14 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 373 amino acids |
Description : | This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. |
Molecular Weight : | 67.140kDa inclusive of tags |
Tissue specificity : | Testis specific. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVG AASGSSAGGSSRGGGSGSGASDLGAGSKKSPRLPKCARCR NHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVA LRRQQAQEEELGISHPIPLPSAAELLVKRENNGSNPCLMT ECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENT PDLVSDSTYYSSFYQPSLFPYYNNLYNCPQYSMALAADSA SGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMEN RHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEAR ASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEP SSFTVTPVIEEDE |
Sequence Similarities : | Belongs to the DMRT family.Contains 1 DM DNA-binding domain. |
Gene Name | DMRT1 doublesex and mab-3 related transcription factor 1 [ Homo sapiens ] |
Official Symbol | DMRT1 |
Synonyms | DMRT1; doublesex and mab-3 related transcription factor 1; doublesex- and mab-3-related transcription factor 1; DM domain expressed in testis 1; DMT1; |
Gene ID | 1761 |
mRNA Refseq | NM_021951 |
Protein Refseq | NP_068770 |
MIM | 602424 |
Uniprot ID | Q9Y5R6 |
Chromosome Location | 9p24.3 |
Function | metal ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
DMRT1-6242H | Recombinant Human DMRT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DMRT1-128HF | Recombinant Full Length Human DMRT1 Protein | +Inquiry |
DMRT1-4649M | Recombinant Mouse DMRT1 Protein | +Inquiry |
DMRT1-11775Z | Recombinant Zebrafish DMRT1 | +Inquiry |
DMRT1-11663Z | Recombinant Zebrafish DMRT1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DMRT1-6898HCL | Recombinant Human DMRT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DMRT1 Products
Required fields are marked with *
My Review for All DMRT1 Products
Required fields are marked with *