Recombinant Human DMRTB1 Protein, GST-tagged

Cat.No. : DMRTB1-2714H
Product Overview : Human DMRTB1 full-length ORF ( AAH29566.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DMRTB1 (DMRT Like Family B With Proline Rich C-Terminal 1) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is DMRTA2.
Molecular Mass : 46.5 kDa
AA Sequence : MPSLAGPPFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENTDDQDAEVLSGEPSQPSSQEQSD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DMRTB1 DMRT-like family B with proline-rich C-terminal, 1 [ Homo sapiens ]
Official Symbol DMRTB1
Synonyms DMRTB1; DMRT-like family B with proline-rich C-terminal, 1; doublesex- and mab-3-related transcription factor B1;
Gene ID 63948
mRNA Refseq NM_033067
Protein Refseq NP_149056
MIM 614805
UniProt ID Q96MA1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DMRTB1 Products

Required fields are marked with *

My Review for All DMRTB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon