Recombinant Human DMRTB1 Protein, GST-tagged
| Cat.No. : | DMRTB1-2714H |
| Product Overview : | Human DMRTB1 full-length ORF ( AAH29566.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DMRTB1 (DMRT Like Family B With Proline Rich C-Terminal 1) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is DMRTA2. |
| Molecular Mass : | 46.5 kDa |
| AA Sequence : | MPSLAGPPFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENTDDQDAEVLSGEPSQPSSQEQSD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DMRTB1 DMRT-like family B with proline-rich C-terminal, 1 [ Homo sapiens ] |
| Official Symbol | DMRTB1 |
| Synonyms | DMRTB1; DMRT-like family B with proline-rich C-terminal, 1; doublesex- and mab-3-related transcription factor B1; |
| Gene ID | 63948 |
| mRNA Refseq | NM_033067 |
| Protein Refseq | NP_149056 |
| MIM | 614805 |
| UniProt ID | Q96MA1 |
| ◆ Recombinant Proteins | ||
| DMRTB1-2210H | Recombinant Human DMRTB1 Protein, MYC/DDK-tagged | +Inquiry |
| DMRTB1-2714H | Recombinant Human DMRTB1 Protein, GST-tagged | +Inquiry |
| DMRTB1-4038HF | Recombinant Full Length Human DMRTB1 Protein, GST-tagged | +Inquiry |
| DMRTB1-2419M | Recombinant Mouse DMRTB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DMRTB1-4654M | Recombinant Mouse DMRTB1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DMRTB1-489HCL | Recombinant Human DMRTB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DMRTB1 Products
Required fields are marked with *
My Review for All DMRTB1 Products
Required fields are marked with *
