Recombinant Human DNAAF2 Protein, GST-tagged
Cat.No. : | DNAAF2-2720H |
Product Overview : | Human DNAAF2 full-length ORF ( AAH11400.1, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a highly conserved protein involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009] |
Molecular Mass : | 57.8 kDa |
AA Sequence : | MGGPGTKSGEPLCPPLLCNQDKETLTLLIQVPRIQPQSLQGDLNPLWYKLRFSAQDLVYSFFLQFAPENKLSTTEPVISISSNNAVIELAKSPESHGHWREWYYGVNNDSLELQECSNSDQLQGKEERVNEESHLTEKEYIEHCNTPTTDSDSSIAVKALQIDSFGLVTCFQQESLDVSQMILGKSQQPESKMQSEFIKEKSATCSNEEKDNLNESVITEEKETDGDHLSSLLNKTTVHNIPGFDSIKETNMQDGSVQVIKDHVTNCAFSFQNSLLYDLD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DNAAF2 dynein, axonemal, assembly factor 2 [ Homo sapiens ] |
Official Symbol | DNAAF2 |
Synonyms | DNAAF2; dynein, axonemal, assembly factor 2; C14orf104, chromosome 14 open reading frame 104; protein kintoun; CILD10; FLJ10563; kintoun; KTU; PF13; dynein assembly factor 2, axonemal; C14orf104; |
Gene ID | 55172 |
mRNA Refseq | NM_001083908 |
Protein Refseq | NP_001077377 |
MIM | 612517 |
UniProt ID | Q9NVR5 |
◆ Recombinant Proteins | ||
DNAAF2-3386Z | Recombinant Zebrafish DNAAF2 | +Inquiry |
Dnaaf2-400M | Recombinant Mouse Dnaaf2 Protein, MYC/DDK-tagged | +Inquiry |
DNAAF2-4666M | Recombinant Mouse DNAAF2 Protein | +Inquiry |
DNAAF2-2720H | Recombinant Human DNAAF2 Protein, GST-tagged | +Inquiry |
DNAAF2-2394H | Recombinant Human DNAAF2 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNAAF2 Products
Required fields are marked with *
My Review for All DNAAF2 Products
Required fields are marked with *
0
Inquiry Basket