Recombinant Human DNAJB3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DNAJB3-4754H |
| Product Overview : | DNAJB3 MS Standard C13 and N15-labeled recombinant protein (NP_001001394) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | DNAJB3 (DnaJ Heat Shock Protein Family (Hsp40) Member B3) is a Protein Coding gene. |
| Molecular Mass : | 16.6 kDa |
| AA Sequence : | MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGEAGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTPFLCLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | DNAJB3 DnaJ heat shock protein family (Hsp40) member B3 [ Homo sapiens (human) ] |
| Official Symbol | DNAJB3 |
| Synonyms | DNAJB3; DnaJ (Hsp40) homolog, subfamily B, member 3; dnaJ homolog subfamily B member 3; HCG3; MGC26879; |
| Gene ID | 414061 |
| mRNA Refseq | NM_001001394 |
| Protein Refseq | NP_001001394 |
| UniProt ID | Q8WWF6 |
| ◆ Recombinant Proteins | ||
| DNAJB3-3175H | Recombinant Human DNAJB3 protein, His-tagged | +Inquiry |
| Dnajb3-1186M | Recombinant Mouse Dnajb3 Protein, MYC/DDK-tagged | +Inquiry |
| DNAJB3-2438M | Recombinant Mouse DNAJB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DNAJB3-4754H | Recombinant Human DNAJB3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DNAJB3-12064H | Recombinant Human DNAJB3, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNAJB3-6886HCL | Recombinant Human DNAJB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJB3 Products
Required fields are marked with *
My Review for All DNAJB3 Products
Required fields are marked with *
