Recombinant Human DNAJC12 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DNAJC12-5329H |
| Product Overview : | DNAJC12 MS Standard C13 and N15-labeled recombinant protein (NP_957714) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Molecular Mass : | 12.3 kDa |
| AA Sequence : | MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTVGFSLGATTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | DNAJC12 DnaJ heat shock protein family (Hsp40) member C12 [ Homo sapiens (human) ] |
| Official Symbol | DNAJC12 |
| Synonyms | DNAJC12; DnaJ (Hsp40) homolog, subfamily C, member 12; dnaJ homolog subfamily C member 12; J domain protein 1; JDP1; j domain-containing protein 1; J domain containing protein 1 (JDP1); RP11-57G10.2; |
| Gene ID | 56521 |
| mRNA Refseq | NM_201262 |
| Protein Refseq | NP_957714 |
| MIM | 606060 |
| UniProt ID | Q9UKB3 |
| ◆ Recombinant Proteins | ||
| DNAJC12-3755H | Recombinant Human DNAJC12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DNAJC12-12074H | Recombinant Human DNAJC12, GST-tagged | +Inquiry |
| DNAJC12-1905R | Recombinant Rat DNAJC12 Protein | +Inquiry |
| DNAJC12-2750H | Recombinant Human DNAJC12 Protein, GST-tagged | +Inquiry |
| DNAJC12-3995HF | Recombinant Full Length Human DNAJC12 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNAJC12-139HKCL | Human DNAJC12 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJC12 Products
Required fields are marked with *
My Review for All DNAJC12 Products
Required fields are marked with *
