Recombinant Human DNAJC5G Protein, GST-tagged
| Cat.No. : | DNAJC5G-2765H |
| Product Overview : | Human DNAJC5G full-length ORF ( NP_775921.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DNAJC5G (DnaJ Heat Shock Protein Family (Hsp40) Member C5 Gamma) is a Protein Coding gene. Among its related pathways are Protein processing in endoplasmic reticulum. An important paralog of this gene is DNAJC5. |
| Molecular Mass : | 47.8 kDa |
| AA Sequence : | MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRYHPDKNPGNAQAAEIFKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILNSCWFKTLVILCTLLTCCCFCCCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFRSEENSEDDF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma [ Homo sapiens ] |
| Official Symbol | DNAJC5G |
| Synonyms | DNAJC5G; DnaJ (Hsp40) homolog, subfamily C, member 5 gamma; dnaJ homolog subfamily C member 5G; CSP gamma; FLJ40417; gamma-CSP; cysteine string protein-gamma; gamma cysteine string protein; gamma-cysteine string protein; CSP-gamma; |
| Gene ID | 285126 |
| mRNA Refseq | NM_173650 |
| Protein Refseq | NP_775921 |
| MIM | 613946 |
| UniProt ID | Q8N7S2 |
| ◆ Recombinant Proteins | ||
| DNAJC5G-2765H | Recombinant Human DNAJC5G Protein, GST-tagged | +Inquiry |
| DNAJC5G-4022HF | Recombinant Full Length Human DNAJC5G Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNAJC5G-6871HCL | Recombinant Human DNAJC5G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJC5G Products
Required fields are marked with *
My Review for All DNAJC5G Products
Required fields are marked with *
