Recombinant Human DNAJC5G Protein, GST-tagged

Cat.No. : DNAJC5G-2765H
Product Overview : Human DNAJC5G full-length ORF ( NP_775921.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DNAJC5G (DnaJ Heat Shock Protein Family (Hsp40) Member C5 Gamma) is a Protein Coding gene. Among its related pathways are Protein processing in endoplasmic reticulum. An important paralog of this gene is DNAJC5.
Molecular Mass : 47.8 kDa
AA Sequence : MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRYHPDKNPGNAQAAEIFKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILNSCWFKTLVILCTLLTCCCFCCCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFRSEENSEDDF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma [ Homo sapiens ]
Official Symbol DNAJC5G
Synonyms DNAJC5G; DnaJ (Hsp40) homolog, subfamily C, member 5 gamma; dnaJ homolog subfamily C member 5G; CSP gamma; FLJ40417; gamma-CSP; cysteine string protein-gamma; gamma cysteine string protein; gamma-cysteine string protein; CSP-gamma;
Gene ID 285126
mRNA Refseq NM_173650
Protein Refseq NP_775921
MIM 613946
UniProt ID Q8N7S2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAJC5G Products

Required fields are marked with *

My Review for All DNAJC5G Products

Required fields are marked with *

0
cart-icon