Recombinant Human DNAJC7 Protein, GST-tagged
| Cat.No. : | DNAJC7-2768H |
| Product Overview : | Human DNAJC7 full-length ORF ( AAH33772, 1 a.a. - 484 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the DNAJ heat shock protein 40 family of proteins that is characterized by two N-terminal tetratricopeptide repeat domains and a C-terminal DNAJ domain. This protein binds the chaperone proteins heat shock proteins 70 and 90 in an ATP-dependent manner and may function as a co-chaperone. Pseudogenes of this gene are found on chromosomes 1 and 6. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009] |
| Molecular Mass : | 78.98 kDa |
| AA Sequence : | MAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DNAJC7 DnaJ (Hsp40) homolog, subfamily C, member 7 [ Homo sapiens ] |
| Official Symbol | DNAJC7 |
| Synonyms | DNAJC7; DnaJ (Hsp40) homolog, subfamily C, member 7; TTC2; dnaJ homolog subfamily C member 7; TPR2; TPR repeat protein 2; tetratricopeptide repeat domain 2; tetratricopeptide repeat protein 2; DJ11; DJC7; |
| Gene ID | 7266 |
| mRNA Refseq | NM_001144766 |
| Protein Refseq | NP_001138238 |
| MIM | 601964 |
| UniProt ID | Q99615 |
| ◆ Recombinant Proteins | ||
| DNAJC7-4024HF | Recombinant Full Length Human DNAJC7 Protein, GST-tagged | +Inquiry |
| DNAJC7-3148C | Recombinant Chicken DNAJC7 | +Inquiry |
| DNAJC7-2768H | Recombinant Human DNAJC7 Protein, GST-tagged | +Inquiry |
| DNAJC7-12090H | Recombinant Human DNAJC7, GST-tagged | +Inquiry |
| DNAJC7-1125R | Recombinant Rhesus Macaque DNAJC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNAJC7-6870HCL | Recombinant Human DNAJC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJC7 Products
Required fields are marked with *
My Review for All DNAJC7 Products
Required fields are marked with *
