Recombinant Human DNAJC9, His-tagged
| Cat.No. : | DNAJC9-26775TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 1-178 of Human DNAJC9 with an N terminal His tag. Predicted MWt: 22 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-178 a.a. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 126 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSL QVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVY DEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAF EKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEE PRIRNIIQQAIDAGEVPSYNAF |
| Sequence Similarities : | Contains 1 J domain. |
| Gene Name | DNAJC9 DnaJ (Hsp40) homolog, subfamily C, member 9 [ Homo sapiens ] |
| Official Symbol | DNAJC9 |
| Synonyms | DNAJC9; DnaJ (Hsp40) homolog, subfamily C, member 9; dnaJ homolog subfamily C member 9; JDD1; SB73; |
| Gene ID | 23234 |
| mRNA Refseq | NM_015190 |
| Protein Refseq | NP_056005 |
| MIM | 611206 |
| Uniprot ID | Q8WXX5 |
| Chromosome Location | 10q22.3 |
| Function | heat shock protein binding; unfolded protein binding; |
| ◆ Recombinant Proteins | ||
| DNAJC9-4722M | Recombinant Mouse DNAJC9 Protein | +Inquiry |
| DNAJC9-426H | Recombinant Human DNAJC9 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DNAJC9-4363C | Recombinant Chicken DNAJC9 | +Inquiry |
| DNAJC9-1357H | Recombinant Human DNAJC9 Protein, His-tagged | +Inquiry |
| DNAJC9-566Z | Recombinant Zebrafish DNAJC9 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNAJC9-6869HCL | Recombinant Human DNAJC9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJC9 Products
Required fields are marked with *
My Review for All DNAJC9 Products
Required fields are marked with *
