Recombinant Human DNAJC9 Protein, GST-tagged
| Cat.No. : | DNAJC9-2770H |
| Product Overview : | Human DNAJC9 full-length ORF (BAG52832.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DNAJC9 (DnaJ Heat Shock Protein Family (Hsp40) Member C9) is a Protein Coding gene. Diseases associated with DNAJC9 include Corneal Degeneration and Recurrent Corneal Erosion. |
| Molecular Mass : | 56.3 kDa |
| AA Sequence : | MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIGAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DNAJC9 DnaJ (Hsp40) homolog, subfamily C, member 9 [ Homo sapiens ] |
| Official Symbol | DNAJC9 |
| Synonyms | DNAJC9; DnaJ (Hsp40) homolog, subfamily C, member 9; dnaJ homolog subfamily C member 9; JDD1; SB73; DnaJ protein SB73; HDJC9; KIAA0974; |
| Gene ID | 23234 |
| mRNA Refseq | NM_015190 |
| Protein Refseq | NP_056005 |
| MIM | 611206 |
| UniProt ID | Q8WXX5 |
| ◆ Recombinant Proteins | ||
| DNAJC9-566Z | Recombinant Zebrafish DNAJC9 | +Inquiry |
| DNAJC9-1357H | Recombinant Human DNAJC9 Protein, His-tagged | +Inquiry |
| DNAJC9-4722M | Recombinant Mouse DNAJC9 Protein | +Inquiry |
| DNAJC9-4363C | Recombinant Chicken DNAJC9 | +Inquiry |
| DNAJC9-26639TH | Recombinant Human DNAJC9, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNAJC9-6869HCL | Recombinant Human DNAJC9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJC9 Products
Required fields are marked with *
My Review for All DNAJC9 Products
Required fields are marked with *
