| Species : |
Human |
| Source : |
E.coli |
| Tag : |
GST |
| Protein Length : |
21-305aa |
| Description : |
The cDNA fragment encoding 21-305aa of Human Deoxyribonuclease gamma (DNASE1L3) was fused with an N-terminal GST-tag and then expressed in E.coli. The product obtained is the recombinant full-length of mature human DNASE1L3 protein. Its purity was determined by using SDS-PAGE and reached up to 90%. Under the reducing conditions, the gel presented a molecular mass band of about 62 kDa. The slightly higher result was attributed to glycosylation. It was also validated by the LC-MS/MS analysis. In-stock DNASE1L3 proteins are offered now. This recombinant DNASE1L3 protein may find uses in the specific antibody generation or the studies of cell biology. DNASE1L3 is a secreted DNASE1-like nuclease, which can digest DNA in chromatin. The deletion of DNASE1L3 can cause anti-DNA responses and autoimmunity in humans and mice. Lee Serpas et al. proved that DNASE1L3 plays a role in circulating plasma DNA homeostasis by enhancing fragmentation and affecting terminal motif frequencies. These results support the unique role of DNASE1L3 as a regulator of physical form and cell-free DNA availability, which may be significant for the DNASE1L3's mechanism of preventing autoimmunity. |
| Form : |
Tris-based buffer,50% glycerol |
| Molecular Mass : |
60.4kDa |
| AA Sequence : |
MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS |
| Purity : |
Greater than 90% as determined by SDS-PAGE. |
| Notes : |
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : |
Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |