Recombinant Human DNASE1L3 protein, GST-tagged

Cat.No. : DNASE1L3-12097H
Product Overview : Recombinant Human DNASE1L3 protein(NP_001243489.1)(21-305aa), fused to GST-tag, was expressed in E. coli.
Availability August 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 21-305aa
Description : The cDNA fragment encoding 21-305aa of Human Deoxyribonuclease gamma (DNASE1L3) was fused with an N-terminal GST-tag and then expressed in E.coli. The product obtained is the recombinant full-length of mature human DNASE1L3 protein. Its purity was determined by using SDS-PAGE and reached up to 90%. Under the reducing conditions, the gel presented a molecular mass band of about 62 kDa. The slightly higher result was attributed to glycosylation. It was also validated by the LC-MS/MS analysis. In-stock DNASE1L3 proteins are offered now. This recombinant DNASE1L3 protein may find uses in the specific antibody generation or the studies of cell biology.
DNASE1L3 is a secreted DNASE1-like nuclease, which can digest DNA in chromatin. The deletion of DNASE1L3 can cause anti-DNA responses and autoimmunity in humans and mice. Lee Serpas et al. proved that DNASE1L3 plays a role in circulating plasma DNA homeostasis by enhancing fragmentation and affecting terminal motif frequencies. These results support the unique role of DNASE1L3 as a regulator of physical form and cell-free DNA availability, which may be significant for the DNASE1L3's mechanism of preventing autoimmunity.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 60.4kDa
AA Sequence : MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
Purity : Greater than 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name DNASE1L3 deoxyribonuclease 1 like 3 [ Homo sapiens (human) ]
Official Symbol DNASE1L3
Synonyms Deoxyribonuclease gamma; Deoxyribonuclease I like 3; Deoxyribonuclease I like III; Deoxyribonuclease I-like 3; DHP 2; DHP2; DNAS1L3; DNase gamma; DNase I homolog protein 2; DNase I homolog protein DHP2; DNase I like 3; DNase I-like 3; DNASE1L3; DNSL3_HUMAN; Liver and spleen DNase; LS DNase; LS-DNase; LSD; SLEB 16; SLEB16
Gene ID 1776
mRNA Refseq NM_001256560.2
Protein Refseq NP_001243489.1
MIM 602244
UniProt ID Q13609

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNASE1L3 Products

Required fields are marked with *

My Review for All DNASE1L3 Products

Required fields are marked with *

0
cart-icon