Recombinant Human DNASE2B Protein, GST-tagged

Cat.No. : DNASE2B-2781H
Product Overview : Human DNASE2B full-length ORF ( NP_490649.1, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this gene product is restricted to the salivary gland and lungs. The gene has been localized to chromosome 1p22.3 adjacent (and in opposite orientation) to the uricase pseudogene. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 44.2 kDa
AA Sequence : MPQLCTRASSSEIPGRLLTTLQSAQGQKFLHFAKSDSFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNASE2B deoxyribonuclease II beta [ Homo sapiens ]
Official Symbol DNASE2B
Synonyms DNASE2B; deoxyribonuclease II beta; deoxyribonuclease-2-beta; DLAD; DNase II beta; endonuclease DLAD; lysosomal DNase II; DNase2-like acid DNase; DNase II-like acid DNase;
Gene ID 58511
mRNA Refseq NM_021233
Protein Refseq NP_067056
MIM 608057
UniProt ID Q8WZ79

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNASE2B Products

Required fields are marked with *

My Review for All DNASE2B Products

Required fields are marked with *

0
cart-icon