Recombinant Human DNER Protein, GST-tagged

Cat.No. : DNER-2784H
Product Overview : Human DNER partial ORF ( NP_620711, 368 a.a. - 476 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DNER (Delta/Notch Like EGF Repeat Containing) is a Protein Coding gene. Among its related pathways are Notch signaling pathway (KEGG) and Canonical and Non-canonical Notch signaling. GO annotations related to this gene include calcium ion binding and clathrin binding. An important paralog of this gene is SLIT1.
Molecular Mass : 37.73 kDa
AA Sequence : NEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPEGYFGSACEEKVDLCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNER delta/notch-like EGF repeat containing [ Homo sapiens ]
Official Symbol DNER
Synonyms DNER; delta/notch-like EGF repeat containing; delta and Notch-like epidermal growth factor-related receptor; bet; UNQ26; H_NH0150O02.1; WUGSC:H_NH0150O02.1; delta-notch-like EGF repeat-containing transmembrane;
Gene ID 92737
mRNA Refseq NM_139072
Protein Refseq NP_620711
MIM 607299
UniProt ID Q8NFT8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNER Products

Required fields are marked with *

My Review for All DNER Products

Required fields are marked with *

0
cart-icon
0
compare icon