Recombinant Human DNER Protein, GST-tagged

• Cat.No.: DNER-2784H
• Product Overview: Human DNER partial ORF ( NP_620711, 368 a.a. - 476 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DNER (Delta/Notch Like EGF Repeat Containing) is a Protein Coding gene. Among its related pathways are Notch signaling pathway (KEGG) and Canonical and Non-canonical Notch signaling. GO annotations related to this gene include calcium ion binding and clathrin binding. An important paralog of this gene is SLIT1.
• Molecular Mass: 37.73 kDa
• AA Sequence: NEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPEGYFGSACEEKVDLCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNER delta/notch-like EGF repeat containing [ Homo sapiens ]
• Official Symbol: DNER
• Synonyms: DNER; delta/notch-like EGF repeat containing; delta and Notch-like epidermal growth factor-related receptor; bet; UNQ26; H_NH0150O02.1; WUGSC:H_NH0150O02.1; delta-notch-like EGF repeat-containing transmembrane
• Gene ID: 92737
• mRNA Refseq: NM_139072
• Protein Refseq: NP_620711
• MIM: 607299
• UniProt ID: Q8NFT8