Recombinant Human DNM1 Protein (2-245 aa), His-SUMO-tagged
Cat.No. : | DNM1-458H |
Product Overview : | Recombinant Human DNM1 Protein (2-245 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-245 aa |
Description : | Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Involved in receptor-mediated endocytosis. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 42.7 kDa |
AA Sequence : | GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | DNM1 dynamin 1 [ Homo sapiens ] |
Official Symbol | DNM1 |
Synonyms | DNM1; dynamin 1; DNM; dynamin-1; |
Gene ID | 1759 |
mRNA Refseq | NM_001005336 |
Protein Refseq | NP_001005336 |
MIM | 602377 |
UniProt ID | Q05193 |
◆ Recombinant Proteins | ||
Dnm1-2617M | Recombinant Mouse Dnm1 Protein, Myc/DDK-tagged | +Inquiry |
DNM1-458H | Recombinant Human DNM1 Protein (2-245 aa), His-SUMO-tagged | +Inquiry |
DNM1-06H | Recombinant Human DNM1 protein, MYC/DDK-tagged | +Inquiry |
DNM1-12103H | Recombinant Human DNM1, GST-tagged | +Inquiry |
DNM1-1922R | Recombinant Rat DNM1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNM1 Products
Required fields are marked with *
My Review for All DNM1 Products
Required fields are marked with *
0
Inquiry Basket