Recombinant Human DNM1 protein, His-tagged
Cat.No. : | DNM1-2822H |
Product Overview : | Recombinant Human DNM1 protein(Q05193)(2-245aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-245aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.2 kDa |
AA Sequence : | GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | DNM1 dynamin 1 [ Homo sapiens ] |
Official Symbol | DNM1 |
Synonyms | DNM1; dynamin 1; DNM; dynamin-1; |
Gene ID | 1759 |
mRNA Refseq | NM_001005336 |
Protein Refseq | NP_001005336 |
MIM | 602377 |
UniProt ID | Q05193 |
◆ Recombinant Proteins | ||
DNM1-1922R | Recombinant Rat DNM1 Protein | +Inquiry |
DNM1-362H | Recombinant Human DNM1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
DNM1-458H | Recombinant Human DNM1 Protein (2-245 aa), His-SUMO-tagged | +Inquiry |
Dnm1-2028M | Recombinant Mouse Dnm1 protein, His & T7-tagged | +Inquiry |
DNM1-1380H | Recombinant Human DNM1 Protein (2-245 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNM1 Products
Required fields are marked with *
My Review for All DNM1 Products
Required fields are marked with *