Recombinant Human DNM1L protein, His-tagged

• Cat.No.: DNM1L-6745H
• Product Overview: Recombinant Human DNM1L protein(69-142 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 69-142 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: HVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: DNM1L dynamin 1-like [ Homo sapiens ]
• Official Symbol: DNM1L
• Synonyms: DNM1L; dynamin 1-like; dynamin-1-like protein; DRP1; DVLP; DYMPLE; HDYNIV; VPS1; dynamin-like protein 4; dynamin-like protein IV; Dnm1p/Vps1p-like protein; dynamin-related protein 1; dynamin family member proline-rich carboxyl-terminal domain less; DLP1; EMPF; DYNIV-11; FLJ41912
• Gene ID: 10059
• mRNA Refseq: NM_005690
• Protein Refseq: NP_005681
• MIM: 603850
• UniProt ID: O00429