Recombinant Human DNMT1 protein, GST-tagged
Cat.No. : | DNMT1-199H |
Product Overview : | Recombinant Human DNMT1(1 a.a. - 110 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 110 a.a. |
Description : | This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | DNMT1 DNA (cytosine-5-)-methyltransferase 1 [ Homo sapiens ] |
Official Symbol | DNMT1 |
Synonyms | DNMT1; DNA (cytosine-5-)-methyltransferase 1; DNMT; DNA (cytosine-5)-methyltransferase 1; CXXC9; MCMT; m.HsaI; DNA MTase HsaI; CXXC finger protein 9; DNA methyltransferase 1; DNA methyltransferase HsaI; CXXC-type zinc finger protein 9; AIM; HSN1E; FLJ16293; MGC104992; |
Gene ID | 1786 |
mRNA Refseq | NM_001379 |
Protein Refseq | NP_001370 |
MIM | 126375 |
UniProt ID | P26358 |
◆ Recombinant Proteins | ||
DNMT13547M | Recombinant Mouse DNMT1 (731-1602) Protein | +Inquiry |
Dnmt1-2620M | Recombinant Mouse Dnmt1 Protein, Myc/DDK-tagged | +Inquiry |
DNMT1-198H | Active Recombinant Human DNMT1 protein, MYC/DDK-tagged | +Inquiry |
DNMT1-02H | Active Recombinant Full Length Human DNMT1 Protein, N-6xHis-FLAG-tagged | +Inquiry |
DNMT1-388H | Recombinant Human DNMT1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNMT1 Products
Required fields are marked with *
My Review for All DNMT1 Products
Required fields are marked with *