Recombinant Human DNMT1 protein, GST-tagged

Cat.No. : DNMT1-199H
Product Overview : Recombinant Human DNMT1(1 a.a. - 110 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 110 a.a.
Description : This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name DNMT1 DNA (cytosine-5-)-methyltransferase 1 [ Homo sapiens ]
Official Symbol DNMT1
Synonyms DNMT1; DNA (cytosine-5-)-methyltransferase 1; DNMT; DNA (cytosine-5)-methyltransferase 1; CXXC9; MCMT; m.HsaI; DNA MTase HsaI; CXXC finger protein 9; DNA methyltransferase 1; DNA methyltransferase HsaI; CXXC-type zinc finger protein 9; AIM; HSN1E; FLJ16293; MGC104992;
Gene ID 1786
mRNA Refseq NM_001379
Protein Refseq NP_001370
MIM 126375
UniProt ID P26358

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNMT1 Products

Required fields are marked with *

My Review for All DNMT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon