Recombinant Human DNMT1 protein, His-tagged
Cat.No. : | DNMT1-2633H |
Product Overview : | Recombinant Human DNMT1 protein(1288-1632 aa), fused to His tag, was expressed in E. coli. |
Availability | August 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1288-1632 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DNMT1 DNA (cytosine-5-)-methyltransferase 1 [ Homo sapiens ] |
Official Symbol | DNMT1 |
Synonyms | DNMT1; DNA (cytosine-5-)-methyltransferase 1; DNMT; DNA (cytosine-5)-methyltransferase 1; CXXC9; MCMT; m.HsaI; DNA MTase HsaI; CXXC finger protein 9; DNA methyltransferase 1; DNA methyltransferase HsaI; CXXC-type zinc finger protein 9; AIM; HSN1E; FLJ16293; MGC104992; |
Gene ID | 1786 |
mRNA Refseq | NM_001130823 |
Protein Refseq | NP_001124295 |
MIM | 126375 |
UniProt ID | P26358 |
◆ Recombinant Proteins | ||
DNMT1-8794Z | Recombinant Zebrafish DNMT1 | +Inquiry |
DNMT1-72H | Recombinant Human DNMT1 protein, GST-tagged | +Inquiry |
DNMT1-388H | Recombinant Human DNMT1, His-tagged | +Inquiry |
DNMT1-778H | Recombinant Human DNMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNMT1-330H | Recombinant Human DNMT1 Protein, His-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNMT1 Products
Required fields are marked with *
My Review for All DNMT1 Products
Required fields are marked with *