Recombinant Human DNMT1 protein, His-tagged

• Cat.No.: DNMT1-2633H
• Product Overview: Recombinant Human DNMT1 protein(1288-1632 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1288-1632 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: VSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DNMT1 DNA (cytosine-5-)-methyltransferase 1 [ Homo sapiens ]
• Official Symbol: DNMT1
• Synonyms: DNMT1; DNA (cytosine-5-)-methyltransferase 1; DNMT; DNA (cytosine-5)-methyltransferase 1; CXXC9; MCMT; m.HsaI; DNA MTase HsaI; CXXC finger protein 9; DNA methyltransferase 1; DNA methyltransferase HsaI; CXXC-type zinc finger protein 9; AIM; HSN1E; FLJ16293; MGC104992
• Gene ID: 1786
• mRNA Refseq: NM_001130823
• Protein Refseq: NP_001124295
• MIM: 126375
• UniProt ID: P26358