Recombinant Human DNTT Protein, GST-tagged

Cat.No. : DNTT-2797H
Product Overview : Human DNTT partial ORF ( AAH12920, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.51 kDa
AA Sequence : MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIEC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNTT deoxynucleotidyltransferase, terminal [ Homo sapiens ]
Official Symbol DNTT
Synonyms DNTT; deoxynucleotidyltransferase, terminal; DNA nucleotidylexotransferase; TDT; Terminal deoxynucleotidyltransferase; terminal transferase; terminal addition enzyme; terminal deoxynucleotidyltransferase; terminal deoxyribonucleotidyltransferase; nucleosidetriphosphate:DNA deoxynucleotidylexotransferase;
Gene ID 1791
mRNA Refseq NM_001017520
Protein Refseq NP_001017520
MIM 187410
UniProt ID P04053

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNTT Products

Required fields are marked with *

My Review for All DNTT Products

Required fields are marked with *

0
cart-icon
0
compare icon