Recombinant Human DNTT Protein, GST-tagged
Cat.No. : | DNTT-2797H |
Product Overview : | Human DNTT partial ORF ( AAH12920, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.51 kDa |
AA Sequence : | MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIEC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DNTT deoxynucleotidyltransferase, terminal [ Homo sapiens ] |
Official Symbol | DNTT |
Synonyms | DNTT; deoxynucleotidyltransferase, terminal; DNA nucleotidylexotransferase; TDT; Terminal deoxynucleotidyltransferase; terminal transferase; terminal addition enzyme; terminal deoxynucleotidyltransferase; terminal deoxyribonucleotidyltransferase; nucleosidetriphosphate:DNA deoxynucleotidylexotransferase; |
Gene ID | 1791 |
mRNA Refseq | NM_001017520 |
Protein Refseq | NP_001017520 |
MIM | 187410 |
UniProt ID | P04053 |
◆ Recombinant Proteins | ||
DNTT-1308R | Recombinant Rhesus monkey DNTT Protein, His-tagged | +Inquiry |
DNTT-318H | Recombinant Human DNTT Protein, GST-His-tagged | +Inquiry |
DNTT-2474M | Recombinant Mouse DNTT Protein, His (Fc)-Avi-tagged | +Inquiry |
DNTT-6941C | Recombinant Chicken DNTT | +Inquiry |
DNTT-01B | Recombinant Bovine DNTT Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNTT-6850HCL | Recombinant Human DNTT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNTT Products
Required fields are marked with *
My Review for All DNTT Products
Required fields are marked with *