Recombinant Human DOCK10 Protein, GST-tagged
Cat.No. : | DOCK10-2804H |
Product Overview : | Human DOCK10 full-length ORF ( ADZ15499.1, 1 a.a. - 542 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the dedicator of cytokinesis protein family. Members of this family are guanosine nucleotide exchange factors for Rho GTPases and defined by the presence of conserved DOCK-homology regions. The encoded protein belongs to the D (or Zizimin) subfamily of DOCK proteins, which also contain an N-terminal pleckstrin homology domain. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq, Mar 2014] |
Molecular Mass : | 59.7 kDa |
AA Sequence : | MKNSNFPAEVKDLTKRIRTVLMATAQMKEHEKDPEMLVDLQYSLANSYASTPELRRTWLESMAKIHARNGDLSEAAMCYIHIAALIAEYLKRKGYWKVEKICTASLLSEDTHPCDSNSLLTTPSGGSMFSMGWPAFLSITPNIKEEGAMKEDSGMQDTPYNENILVEQLYMCVEFLWKSERYELIADVNKPIIAVFEKQRDFKKLSDLYYDIHRSYLKVAEVVNSEKRLFGRYYRVAFYGQGFFEEEEGKEYIYKEPKLTGLSEISQRLLKLYADKFGADNVKIIQDSNKVNPKDLDPKYAYIQVTYVTPFFEEKEIEDRKTDFEMHHNINRFVFETPFTLSGKKHGGVAEQCKRRTILTTSHLFPYVKKRIQVISQSSTELNPIEVAIDEMSKKVSELNQLCTMEEVDMIRLQLKLQGSVSVKVNAGPMAYARAFLEETNAKKYPDNQVKLLKEIFRQFADACGQALDVNERLIKEDQLEYQEELRSHYKDMLSELSTVMNEQITGRDDLSKRGVDQTCTRVISKATPALPTVSISSSAEV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DOCK10 dedicator of cytokinesis 10 [ Homo sapiens ] |
Official Symbol | DOCK10 |
Synonyms | DOCK10; dedicator of cytokinesis 10; dedicator of cytokinesis protein 10; KIAA0694; ZIZ3; zizimin3; zizimin-3; protein zizimin 3; dopamine receptor interacting protein 2; DRIP2; Nbla10300; DKFZp781A1532; |
Gene ID | 55619 |
mRNA Refseq | NM_014689 |
Protein Refseq | NP_055504 |
MIM | 611518 |
UniProt ID | Q96BY6 |
◆ Recombinant Proteins | ||
DOCK10-2804H | Recombinant Human DOCK10 Protein, GST-tagged | +Inquiry |
Dock10-1366M | Recombinant Mouse Dock10 Protein, His-tagged | +Inquiry |
DOCK10-4070HF | Recombinant Full Length Human DOCK10 Protein, GST-tagged | +Inquiry |
DOCK10-1365H | Recombinant Human DOCK10 Protein, His-tagged | +Inquiry |
DOCK10-12117H | Recombinant Human DOCK10, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DOCK10 Products
Required fields are marked with *
My Review for All DOCK10 Products
Required fields are marked with *
0
Inquiry Basket