Recombinant Human DOK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DOK1-2125H
• Product Overview: DOK1 MS Standard C13 and N15-labeled recombinant protein (NP_001372) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is part of a signal transduction pathway downstream of receptor tyrosine kinases. The encoded protein is a scaffold protein that helps form a platform for the assembly of multiprotein signaling complexes. Several transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 52.2 kDa
• AA Sequence: MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKGSSSGGGRGSSRRLDCKVIRLAECVSVAPVTVETPPEPGATAFRLDTAQRSHLLAADAPSSAAWVQTLCRNAFPKGSWTLAPTDNPPKLSALEMLENSLYSPTWEGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGAQSQILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQKAQGKAGQGHDVLRADSHEGEVAEGKLPSPPGPQELLDSPPALYAEPLDSLRIAPCPSQDSLYSDPLDSTSAQAGEGVQRKKPLYWDLYEHAQQQLLKAKLTDPKEDPIYDEPEGLAPVPPQGLYDLPREPKDAWWCQARVKEEGYELPYNPATDDYAVPPPRSTKPLLAPKPQGPAFPEPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DOK1 docking protein 1 [ Homo sapiens (human) ]
• Official Symbol: DOK1
• Synonyms: DOK1; docking protein 1, 62kDa (downstream of tyrosine kinase 1); docking protein 1, 62kD (downstream of tyrosine kinase 1); docking protein 1; p62dok; pp62; p62(dok); Downstream of tyrosine kinase 1; docking protein 1 (downstream of tyrosine kinase 1); P62DOK; MGC117395; MGC138860
• Gene ID: 1796
• mRNA Refseq: NM_001381
• Protein Refseq: NP_001372
• MIM: 602919
• UniProt ID: Q99704