Recombinant Human DOK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DOK1-2125H
Product Overview : DOK1 MS Standard C13 and N15-labeled recombinant protein (NP_001372) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is part of a signal transduction pathway downstream of receptor tyrosine kinases. The encoded protein is a scaffold protein that helps form a platform for the assembly of multiprotein signaling complexes. Several transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 52.2 kDa
AA Sequence : MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKGSSSGGGRGSSRRLDCKVIRLAECVSVAPVTVETPPEPGATAFRLDTAQRSHLLAADAPSSAAWVQTLCRNAFPKGSWTLAPTDNPPKLSALEMLENSLYSPTWEGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGAQSQILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQKAQGKAGQGHDVLRADSHEGEVAEGKLPSPPGPQELLDSPPALYAEPLDSLRIAPCPSQDSLYSDPLDSTSAQAGEGVQRKKPLYWDLYEHAQQQLLKAKLTDPKEDPIYDEPEGLAPVPPQGLYDLPREPKDAWWCQARVKEEGYELPYNPATDDYAVPPPRSTKPLLAPKPQGPAFPEPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DOK1 docking protein 1 [ Homo sapiens (human) ]
Official Symbol DOK1
Synonyms DOK1; docking protein 1, 62kDa (downstream of tyrosine kinase 1); docking protein 1, 62kD (downstream of tyrosine kinase 1); docking protein 1; p62dok; pp62; p62(dok); Downstream of tyrosine kinase 1; docking protein 1 (downstream of tyrosine kinase 1); P62DOK; MGC117395; MGC138860;
Gene ID 1796
mRNA Refseq NM_001381
Protein Refseq NP_001372
MIM 602919
UniProt ID Q99704

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DOK1 Products

Required fields are marked with *

My Review for All DOK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon