Recombinant Human DPAGT1 Protein, GST-tagged

Cat.No. : DPAGT1-2822H
Product Overview : Human DPAGT1 partial ORF ( NP_001373, 296 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is an enzyme that catalyzes the first step in the dolichol-linked oligosaccharide pathway for glycoprotein biosynthesis. This enzyme belongs to the glycosyltransferase family 4. This protein is an integral membrane protein of the endoplasmic reticulum. The congenital disorder of glycosylation type Ij is caused by mutation in the gene encoding this enzyme. [provided by RefSeq, Jul 2008]
Molecular Mass : 34.76 kDa
AA Sequence : IIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLGPIHER
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DPAGT1 dolichyl-phosphate (UDP-N-acetylglucosamine) N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase) [ Homo sapiens ]
Official Symbol DPAGT1
Synonyms DPAGT1; dolichyl-phosphate (UDP-N-acetylglucosamine) N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase); DPAGT, DPAGT2; UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase; ALG7; CDG Ij; D11S366; DGPT; GPT; GlcNAc-1-P transferase; N-acetylglucosamine-1-phosphate transferase; dolichyl-phosphate alpha-N-acetylglucosaminyltransferase; UDP-GlcNAc:dolichyl-phosphate N-acetylglucosaminephosphotransferase; dolichyl-phosphate (UDP-N-acetylglucosamine) N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P tra; G1PT; UAGT; UGAT; CDG1J; DPAGT; CDG-Ij; DPAGT2;
Gene ID 1798
mRNA Refseq NM_001382
Protein Refseq NP_001373
MIM 191350
UniProt ID Q9H3H5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DPAGT1 Products

Required fields are marked with *

My Review for All DPAGT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon