Recombinant Human DPAGT1 Protein, GST-tagged
Cat.No. : | DPAGT1-2822H |
Product Overview : | Human DPAGT1 partial ORF ( NP_001373, 296 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an enzyme that catalyzes the first step in the dolichol-linked oligosaccharide pathway for glycoprotein biosynthesis. This enzyme belongs to the glycosyltransferase family 4. This protein is an integral membrane protein of the endoplasmic reticulum. The congenital disorder of glycosylation type Ij is caused by mutation in the gene encoding this enzyme. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 34.76 kDa |
AA Sequence : | IIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLGPIHER |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DPAGT1 dolichyl-phosphate (UDP-N-acetylglucosamine) N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase) [ Homo sapiens ] |
Official Symbol | DPAGT1 |
Synonyms | DPAGT1; dolichyl-phosphate (UDP-N-acetylglucosamine) N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase); DPAGT, DPAGT2; UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase; ALG7; CDG Ij; D11S366; DGPT; GPT; GlcNAc-1-P transferase; N-acetylglucosamine-1-phosphate transferase; dolichyl-phosphate alpha-N-acetylglucosaminyltransferase; UDP-GlcNAc:dolichyl-phosphate N-acetylglucosaminephosphotransferase; dolichyl-phosphate (UDP-N-acetylglucosamine) N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P tra; G1PT; UAGT; UGAT; CDG1J; DPAGT; CDG-Ij; DPAGT2; |
Gene ID | 1798 |
mRNA Refseq | NM_001382 |
Protein Refseq | NP_001373 |
MIM | 191350 |
UniProt ID | Q9H3H5 |
◆ Recombinant Proteins | ||
DPAGT1-1316R | Recombinant Rhesus monkey DPAGT1 Protein, His-tagged | +Inquiry |
DPAGT1-2822H | Recombinant Human DPAGT1 Protein, GST-tagged | +Inquiry |
DPAGT1-2492M | Recombinant Mouse DPAGT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DPAGT1-4776M | Recombinant Mouse DPAGT1 Protein | +Inquiry |
DPAGT1-5545Z | Recombinant Zebrafish DPAGT1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPAGT1-6840HCL | Recombinant Human DPAGT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPAGT1 Products
Required fields are marked with *
My Review for All DPAGT1 Products
Required fields are marked with *