Recombinant Human DPP6 Protein, GST-tagged

Cat.No. : DPP6-2847H
Product Overview : Human DPP6 full-length ORF (1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a single-pass type II membrane protein that is a member of the peptidase S9B family of serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Variations in this gene may be associated with susceptibility to amyotrophic lateral sclerosis and with idiopathic ventricular fibrillation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
Molecular Mass : 46.5 kDa
AA Sequence : MELAALGLSPCPRLLHAELLPGLLTVFSLRFLQDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQVQYACYSVLNLEQDIPFMEKDLTGVQGLLLQQTRLCCGGRC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DPP6 dipeptidyl-peptidase 6 [ Homo sapiens ]
Official Symbol DPP6
Synonyms DPP6; dipeptidyl-peptidase 6; dipeptidylpeptidase 6 , dipeptidylpeptidase VI; dipeptidyl aminopeptidase-like protein 6; DPPX; DPP VI; dipeptidylpeptidase 6; dipeptidyl peptidase 6; dipeptidylpeptidase VI; dipeptidyl peptidase VI; dipeptidyl peptidase IV-like protein; dipeptidyl peptidase IV-related protein; dipeptidyl aminopeptidase-related protein; dipeptidyl aminopeptidase IV-related protein; VF2; FLJ55680; MGC46605;
Gene ID 1804
mRNA Refseq NM_001039350
Protein Refseq NP_001034439
MIM 126141
UniProt ID P42658

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DPP6 Products

Required fields are marked with *

My Review for All DPP6 Products

Required fields are marked with *

0
cart-icon