Recombinant Human DPP6 Protein, GST-tagged
Cat.No. : | DPP6-2847H |
Product Overview : | Human DPP6 full-length ORF (1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a single-pass type II membrane protein that is a member of the peptidase S9B family of serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Variations in this gene may be associated with susceptibility to amyotrophic lateral sclerosis and with idiopathic ventricular fibrillation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014] |
Molecular Mass : | 46.5 kDa |
AA Sequence : | MELAALGLSPCPRLLHAELLPGLLTVFSLRFLQDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQVQYACYSVLNLEQDIPFMEKDLTGVQGLLLQQTRLCCGGRC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DPP6 dipeptidyl-peptidase 6 [ Homo sapiens ] |
Official Symbol | DPP6 |
Synonyms | DPP6; dipeptidyl-peptidase 6; dipeptidylpeptidase 6 , dipeptidylpeptidase VI; dipeptidyl aminopeptidase-like protein 6; DPPX; DPP VI; dipeptidylpeptidase 6; dipeptidyl peptidase 6; dipeptidylpeptidase VI; dipeptidyl peptidase VI; dipeptidyl peptidase IV-like protein; dipeptidyl peptidase IV-related protein; dipeptidyl aminopeptidase-related protein; dipeptidyl aminopeptidase IV-related protein; VF2; FLJ55680; MGC46605; |
Gene ID | 1804 |
mRNA Refseq | NM_001039350 |
Protein Refseq | NP_001034439 |
MIM | 126141 |
UniProt ID | P42658 |
◆ Recombinant Proteins | ||
DPP6-1125HFL | Recombinant Full Length Human DPP6 Protein, C-Flag-tagged | +Inquiry |
DPP6-1946R | Recombinant Rat DPP6 protein, His-tagged | +Inquiry |
DPP6-3851H | Recombinant Human DPP6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DPP6-1055H | Recombinant Human DPP6 protein, His & T7-tagged | +Inquiry |
Dpp6-2642M | Recombinant Mouse Dpp6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
DPP6-001H | Recombinant Human DPP6 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPP6 Products
Required fields are marked with *
My Review for All DPP6 Products
Required fields are marked with *
0
Inquiry Basket