Recombinant Human DPPA2 Protein, GST-tagged
| Cat.No. : | DPPA2-2852H |
| Product Overview : | Human DPPA2 full-length ORF ( AAH18070.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DPPA2 (Developmental Pluripotency Associated 2) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and chromatin binding. An important paralog of this gene is DPPA4. |
| Molecular Mass : | 60.2 kDa |
| AA Sequence : | MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DPPA2 developmental pluripotency associated 2 [ Homo sapiens ] |
| Official Symbol | DPPA2 |
| Synonyms | DPPA2; developmental pluripotency associated 2; developmental pluripotency-associated protein 2; cancer/testis antigen 100; CT100; PESCRG1; embryonic stem cell (ESC) associated transcript 15-2; pluripotent embryonic stem cell-related gene 1 protein; ECAT15-2; |
| Gene ID | 151871 |
| mRNA Refseq | NM_138815 |
| Protein Refseq | NP_620170 |
| MIM | 614445 |
| UniProt ID | Q7Z7J5 |
| ◆ Recombinant Proteins | ||
| DPPA2-1324R | Recombinant Rhesus monkey DPPA2 Protein, His-tagged | +Inquiry |
| DPPA2-2852H | Recombinant Human DPPA2 Protein, GST-tagged | +Inquiry |
| DPPA2-1149R | Recombinant Rhesus Macaque DPPA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DPPA2-4149HF | Recombinant Full Length Human DPPA2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DPPA2-6827HCL | Recombinant Human DPPA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPPA2 Products
Required fields are marked with *
My Review for All DPPA2 Products
Required fields are marked with *
