Recombinant Human DPYSL4 protein, His-GST&V5-Myc-tagged

Cat.No. : DPYSL4-785H
Product Overview : Recombinant Human DPYSL4 protein(O14531)(280-560aa), fused with N-terminal His and GST tag and C-terminal V5 and Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His&Myc&V5
Protein Length : 280-560aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 66.8 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : TASLGTDGSHYWSKNWAKAAAFVTSPPVNPDPTTADHLTCLLSSGDLQVTGSAHCTFTTAQKAVGKDNFALIPEGTNGIEERMSMVWEKCVASGKMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVIWNPKATKIISAKTHNLNVEYNIFEGVECRGAPAVVISQGRVALEDGKMFVTPGAGRFVPRKTFPDFVYKRIKARNRLAEIHGVPRGVYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIMA
Gene Name DPYSL4 dihydropyrimidinase-like 4 [ Homo sapiens ]
Official Symbol DPYSL4
Synonyms DPYSL4; dihydropyrimidinase-like 4; dihydropyrimidinase-related protein 4; DRP 4; ULIP4; CRMP-3; ULIP-4; UNC33-like phosphoprotein 4; collapsin response mediator protein 3; CRMP3; DRP-4;
Gene ID 10570
mRNA Refseq NM_006426
Protein Refseq NP_006417
MIM 608407
UniProt ID O14531

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DPYSL4 Products

Required fields are marked with *

My Review for All DPYSL4 Products

Required fields are marked with *

0
cart-icon