Recombinant Human DPYSL4 protein, His-GST&V5-Myc-tagged
Cat.No. : | DPYSL4-785H |
Product Overview : | Recombinant Human DPYSL4 protein(O14531)(280-560aa), fused with N-terminal His and GST tag and C-terminal V5 and Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc&V5 |
Protein Length : | 280-560aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 66.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | TASLGTDGSHYWSKNWAKAAAFVTSPPVNPDPTTADHLTCLLSSGDLQVTGSAHCTFTTAQKAVGKDNFALIPEGTNGIEERMSMVWEKCVASGKMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVIWNPKATKIISAKTHNLNVEYNIFEGVECRGAPAVVISQGRVALEDGKMFVTPGAGRFVPRKTFPDFVYKRIKARNRLAEIHGVPRGVYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIMA |
Gene Name | DPYSL4 dihydropyrimidinase-like 4 [ Homo sapiens ] |
Official Symbol | DPYSL4 |
Synonyms | DPYSL4; dihydropyrimidinase-like 4; dihydropyrimidinase-related protein 4; DRP 4; ULIP4; CRMP-3; ULIP-4; UNC33-like phosphoprotein 4; collapsin response mediator protein 3; CRMP3; DRP-4; |
Gene ID | 10570 |
mRNA Refseq | NM_006426 |
Protein Refseq | NP_006417 |
MIM | 608407 |
UniProt ID | O14531 |
◆ Recombinant Proteins | ||
DPYSL4-5771C | Recombinant Chicken DPYSL4 | +Inquiry |
DPYSL4-2866H | Recombinant Human DPYSL4 Protein, GST-tagged | +Inquiry |
DPYSL4-4171HF | Recombinant Full Length Human DPYSL4 Protein, GST-tagged | +Inquiry |
DPYSL4-2531H | Recombinant Human DPYSL4 Protein, MYC/DDK-tagged | +Inquiry |
DPYSL4-2712Z | Recombinant Zebrafish DPYSL4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPYSL4-508HCL | Recombinant Human DPYSL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPYSL4 Products
Required fields are marked with *
My Review for All DPYSL4 Products
Required fields are marked with *