Recombinant Human DRD1
| Cat.No. : | DRD1-10H | 
| Product Overview : | Recombinant Human DRD1, fused without tag, was expressed in wheat germ. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Description : | This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events. Alternate transcription initiation sites result in two transcript variants of this gene. | 
| Form : | Liquid | 
| Molecular Mass : | 49.3 kDa | 
| AA Sequence : | MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAV LVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTL SVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQI RRIAALERAAVHAKNCQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHH EPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT | 
| Applications : | Antibody Production; Functional Study; Compound Screening | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. | 
| Gene Name | DRD1 dopamine receptor D1 [ Homo sapiens (human) ] | 
| Official Symbol | DRD1 | 
| Synonyms | DRD1; dopamine receptor D1; DADR; DRD1A; D(1A) dopamine receptor; dopamine D1 receptor | 
| Gene ID | 1812 | 
| mRNA Refseq | NM_000794 | 
| Protein Refseq | NP_000785 | 
| MIM | 126449 | 
| UniProt ID | P21728 | 
| Chromosome Location | 5q35.1 | 
| Pathway | Amine ligand-binding receptor; Amphetamine addiction; Class A/1 (Rhodopsin-like receptors) | 
| Function | G-protein coupled amine receptor activity; dopamine binding; dopamine neurotransmitter receptor activity | 
| ◆ Recombinant Proteins | ||
| RFL8615XF | Recombinant Full Length Xenopus Laevis D(1A) Dopamine Receptor Protein, His-Tagged | +Inquiry | 
| DRD1-1211H | Recombinant Human DRD1 Full Length Transmembrane protein(VLPs) | +Inquiry | 
| DRD1-1098HFL | Recombinant Human DRD1 protein, His&Flag-tagged | +Inquiry | 
| DRD1-28086TH | Recombinant Human DRD1, C-MYC-tagged | +Inquiry | 
| DRD1-1269M | Recombinant Mouse DRD1 protein, His-GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DRD1-6818HCL | Recombinant Human DRD1 293 Cell Lysate | +Inquiry | 
| DRD1-20HL | Recombinant Human DRD1 HEK293T cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All DRD1 Products
Required fields are marked with *
My Review for All DRD1 Products
Required fields are marked with *
  
        
    
      
            