Recombinant Human DRD1
Cat.No. : | DRD1-10H |
Product Overview : | Recombinant Human DRD1, fused without tag, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events. Alternate transcription initiation sites result in two transcript variants of this gene. |
Form : | Liquid |
Molecular Mass : | 49.3 kDa |
AA Sequence : | MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAV LVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTL SVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQI RRIAALERAAVHAKNCQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHH EPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT |
Applications : | Antibody Production; Functional Study; Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | DRD1 dopamine receptor D1 [ Homo sapiens (human) ] |
Official Symbol | DRD1 |
Synonyms | DRD1; dopamine receptor D1; DADR; DRD1A; D(1A) dopamine receptor; dopamine D1 receptor |
Gene ID | 1812 |
mRNA Refseq | NM_000794 |
Protein Refseq | NP_000785 |
MIM | 126449 |
UniProt ID | P21728 |
Chromosome Location | 5q35.1 |
Pathway | Amine ligand-binding receptor; Amphetamine addiction; Class A/1 (Rhodopsin-like receptors) |
Function | G-protein coupled amine receptor activity; dopamine binding; dopamine neurotransmitter receptor activity |
◆ Recombinant Proteins | ||
DRD1-3904C | Recombinant Chicken DRD1 | +Inquiry |
DRD1-3647H | Recombinant Human DRD1 protein, GST-tagged | +Inquiry |
RFL17407SF | Recombinant Full Length Pig D(1A) Dopamine Receptor(Drd1) Protein, His-Tagged | +Inquiry |
DRD1-15H | Recombinant Human DRD1 protein, His-tagged | +Inquiry |
Drd1-1380R | Recombinant Rat Drd1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DRD1-20HL | Recombinant Human DRD1 HEK293T cell lysate | +Inquiry |
DRD1-6818HCL | Recombinant Human DRD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DRD1 Products
Required fields are marked with *
My Review for All DRD1 Products
Required fields are marked with *
0
Inquiry Basket