Recombinant Human DRD1 protein, GST-tagged
Cat.No. : | DRD1-3647H |
Product Overview : | Recombinant Human DRD1 protein(338-446 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 338-446 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DRD1 dopamine receptor D1 [ Homo sapiens ] |
Official Symbol | DRD1 |
Synonyms | DRD1; dopamine receptor D1; D(1A) dopamine receptor; dopamine D1 receptor; DADR; DRD1A; |
Gene ID | 1812 |
mRNA Refseq | NM_000794 |
Protein Refseq | NP_000785 |
MIM | 126449 |
UniProt ID | P21728 |
◆ Recombinant Proteins | ||
DRD1-1098HFL | Recombinant Human DRD1 protein, His&Flag-tagged | +Inquiry |
Drd1-1380R | Recombinant Rat Drd1 Protein, His-tagged | +Inquiry |
DRD1-28086TH | Recombinant Human DRD1, C-MYC-tagged | +Inquiry |
RFL8615XF | Recombinant Full Length Xenopus Laevis D(1A) Dopamine Receptor Protein, His-Tagged | +Inquiry |
RFL23445RF | Recombinant Full Length Rat D(1A) Dopamine Receptor Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DRD1-20HL | Recombinant Human DRD1 HEK293T cell lysate | +Inquiry |
DRD1-6818HCL | Recombinant Human DRD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DRD1 Products
Required fields are marked with *
My Review for All DRD1 Products
Required fields are marked with *
0
Inquiry Basket