Recombinant Human DRD1 protein, GST-tagged
| Cat.No. : | DRD1-3647H |
| Product Overview : | Recombinant Human DRD1 protein(338-446 aa), fused to GST tag, was expressed in E. coli. |
| Availability | January 31, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 338-446 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | DRD1 dopamine receptor D1 [ Homo sapiens ] |
| Official Symbol | DRD1 |
| Synonyms | DRD1; dopamine receptor D1; D(1A) dopamine receptor; dopamine D1 receptor; DADR; DRD1A; |
| Gene ID | 1812 |
| mRNA Refseq | NM_000794 |
| Protein Refseq | NP_000785 |
| MIM | 126449 |
| UniProt ID | P21728 |
| ◆ Recombinant Proteins | ||
| Drd1-1380R | Recombinant Rat Drd1 Protein, His-tagged | +Inquiry |
| DRD1-1211H | Recombinant Human DRD1 Full Length Transmembrane protein(VLPs) | +Inquiry |
| DRD1-1329R | Recombinant Rhesus monkey DRD1 Protein, His-tagged | +Inquiry |
| DRD1-1154R | Recombinant Rhesus Macaque DRD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DRD1-3904C | Recombinant Chicken DRD1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DRD1-20HL | Recombinant Human DRD1 HEK293T cell lysate | +Inquiry |
| DRD1-6818HCL | Recombinant Human DRD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DRD1 Products
Required fields are marked with *
My Review for All DRD1 Products
Required fields are marked with *
