Recombinant Human DRD3 protein, His-tagged
| Cat.No. : | DRD3-2945H |
| Product Overview : | Recombinant Human DRD3 protein, fused to His tag, was expressed in E. coli. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | DRD3 dopamine receptor D3 [ Homo sapiens ] |
| Official Symbol | DRD3 |
| Synonyms | DRD3; dopamine receptor D3; D(3) dopamine receptor; essential tremor 1; dopamine D3 receptor; D3DR; ETM1; FET1; MGC149204; MGC149205; |
| Gene ID | 1814 |
| mRNA Refseq | NM_000796 |
| Protein Refseq | NP_000787 |
| MIM | 126451 |
| UniProt ID | P35462 |
| ◆ Recombinant Proteins | ||
| Drd3-1382M | Recombinant Mouse Drd3 Protein, His&GST-tagged | +Inquiry |
| RFL3385CF | Recombinant Full Length Chlorocebus Aethiops D(3) Dopamine Receptor Protein, His-Tagged | +Inquiry |
| DRD3-1957R | Recombinant Rat DRD3 Protein | +Inquiry |
| DRD3-9690Z | Recombinant Zebrafish DRD3 | +Inquiry |
| DRD3-2945H | Recombinant Human DRD3 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DRD3 Products
Required fields are marked with *
My Review for All DRD3 Products
Required fields are marked with *
