Recombinant Human DSC1 protein(791-870 aa), C-His-tagged
| Cat.No. : | DSC1-2832H |
| Product Overview : | Recombinant Human DSC1 protein(Q08554)(791-870 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 791-870 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | SNKGGGHQTLESVKGVGQGDTGRYAYTDWQSFTQPRLGEKVYLCGQDEEHKHCEDYVCSYNYEGKGSLAGSVGCCSDRQE |
| Gene Name | DSC1 desmocollin 1 [ Homo sapiens ] |
| Official Symbol | DSC1 |
| Synonyms | DSC1; desmocollin 1; desmocollin-1; CDHF1; cadherin family member 1; desmosomal glycoprotein 2/3; DG2/DG3; |
| Gene ID | 1823 |
| mRNA Refseq | NM_004948 |
| Protein Refseq | NP_004939 |
| MIM | 125643 |
| UniProt ID | Q08554 |
| ◆ Cell & Tissue Lysates | ||
| DSC1-144HKCL | Human DSC1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSC1 Products
Required fields are marked with *
My Review for All DSC1 Products
Required fields are marked with *



