Recombinant Human DSC1 protein(791-870 aa), C-His-tagged
Cat.No. : | DSC1-2832H |
Product Overview : | Recombinant Human DSC1 protein(Q08554)(791-870 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 791-870 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SNKGGGHQTLESVKGVGQGDTGRYAYTDWQSFTQPRLGEKVYLCGQDEEHKHCEDYVCSYNYEGKGSLAGSVGCCSDRQE |
Gene Name | DSC1 desmocollin 1 [ Homo sapiens ] |
Official Symbol | DSC1 |
Synonyms | DSC1; desmocollin 1; desmocollin-1; CDHF1; cadherin family member 1; desmosomal glycoprotein 2/3; DG2/DG3; |
Gene ID | 1823 |
mRNA Refseq | NM_004948 |
Protein Refseq | NP_004939 |
MIM | 125643 |
UniProt ID | Q08554 |
◆ Recombinant Proteins | ||
DSC1-476H | Recombinant Human DSC1 Protein, His-tagged | +Inquiry |
DSC1-6424H | Recombinant Human DSC1 protein, His-tagged | +Inquiry |
DSC1-1384H | Recombinant Human DSC1 Protein, His&GST-tagged | +Inquiry |
Dsc1-477M | Recombinant Mouse Dsc1 Protein, His-tagged | +Inquiry |
DSC1-3706H | Recombinant Human DSC1 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSC1 Products
Required fields are marked with *
My Review for All DSC1 Products
Required fields are marked with *