Recombinant Human DSC1 protein, GST-tagged
| Cat.No. : | DSC1-3706H |
| Product Overview : | Recombinant Human DSC1 protein(607-689 aa), fused to GST tag, was expressed in E. coli. |
| Availability | August 19, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 607-689 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTRDVRPNVIL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | DSC1 desmocollin 1 [ Homo sapiens ] |
| Official Symbol | DSC1 |
| Synonyms | DSC1; desmocollin 1; desmocollin-1; CDHF1; cadherin family member 1; desmosomal glycoprotein 2/3; DG2/DG3; |
| Gene ID | 1823 |
| mRNA Refseq | NM_004948 |
| Protein Refseq | NP_004939 |
| MIM | 125643 |
| UniProt ID | Q08554 |
| ◆ Recombinant Proteins | ||
| DSC1-476H | Recombinant Human DSC1 Protein, His-tagged | +Inquiry |
| DSC1-3706H | Recombinant Human DSC1 protein, GST-tagged | +Inquiry |
| Dsc1-477M | Recombinant Mouse Dsc1 Protein, His-tagged | +Inquiry |
| RFL20506MF | Recombinant Full Length Mouse Desmocollin-1(Dsc1) Protein, His-Tagged | +Inquiry |
| DSC1-2832H | Recombinant Human DSC1 protein(791-870 aa), C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DSC1-144HKCL | Human DSC1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSC1 Products
Required fields are marked with *
My Review for All DSC1 Products
Required fields are marked with *



