Recombinant Human DSC3 Protein, GST-tagged

Cat.No. : DSC3-2881H
Product Overview : Human DSC3 partial ORF ( NP_001932, 585 a.a. - 684 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation. The desmosomal family members are arranged in two clusters on chromosome 18, occupying less than 650 kb combined. Mutations in this gene are a cause of hypotrichosis and recurrent skin vesicles disorder. The protein can act as an autoantigen in pemphigus diseases, and it is also considered to be a biomarker for some cancers. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2014]
Molecular Mass : 36.74 kDa
AA Sequence : CKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVNDTAARLSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRST
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DSC3 desmocollin 3 [ Homo sapiens ]
Official Symbol DSC3
Synonyms DSC3; desmocollin 3; DSC4; desmocollin-3; CDHF3; DSC; DSC1; DSC2; desmocollin-4; cadherin family member 3; HT-CP;
Gene ID 1825
mRNA Refseq NM_001941
Protein Refseq NP_001932
MIM 600271
UniProt ID Q14574

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DSC3 Products

Required fields are marked with *

My Review for All DSC3 Products

Required fields are marked with *

0
cart-icon