Recombinant Human DSC3 Protein, GST-tagged
Cat.No. : | DSC3-2881H |
Product Overview : | Human DSC3 partial ORF ( NP_001932, 585 a.a. - 684 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation. The desmosomal family members are arranged in two clusters on chromosome 18, occupying less than 650 kb combined. Mutations in this gene are a cause of hypotrichosis and recurrent skin vesicles disorder. The protein can act as an autoantigen in pemphigus diseases, and it is also considered to be a biomarker for some cancers. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | CKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVNDTAARLSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRST |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DSC3 desmocollin 3 [ Homo sapiens ] |
Official Symbol | DSC3 |
Synonyms | DSC3; desmocollin 3; DSC4; desmocollin-3; CDHF3; DSC; DSC1; DSC2; desmocollin-4; cadherin family member 3; HT-CP; |
Gene ID | 1825 |
mRNA Refseq | NM_001941 |
Protein Refseq | NP_001932 |
MIM | 600271 |
UniProt ID | Q14574 |
◆ Recombinant Proteins | ||
Dsc3-1385M | Recombinant Mouse Dsc3 Protein, His-tagged | +Inquiry |
Dsc3-2904M | Recombinant Mouse Dsc3 Full Length Transmembrane protein, His-tagged | +Inquiry |
Dsc3-1386R | Recombinant Rat Dsc3 Protein, His-tagged | +Inquiry |
DSC3-2881H | Recombinant Human DSC3 Protein, GST-tagged | +Inquiry |
RFL14639SF | Recombinant Full Length Schizosaccharomyces Pombe Upf0645 Membrane Protein C20H4.02(Spac20H4.02) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSC3 Products
Required fields are marked with *
My Review for All DSC3 Products
Required fields are marked with *