Recombinant Human DSCAM, His-tagged

Cat.No. : DSCAM-12170H
Product Overview : Recombinant Human DSCAM Protein is produced by E. coli expression system. The target protein is expressed with sequence Gly1913-Glu2012 of human DSCAM (Accession #NP_001380), fused with a His tag at the N-terminus.
Availability June 12, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 1913-2012 aa
Form : Lyophilized from sterile PBS, pH7.5, 0.5% SKL, 5% Trehalose, 5% Mannitol.
Molecular Mass : 15 kDa
AASequence : MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSRGGPGTSRDLSLGQACLEPQKSRTLKRPTVLEPIPMEAASSASSTREGQSWQPGAVATLPQREGAELGQAAKMSSSQESLLDSRGHLKGNNPYAKSYTLV
Endotoxin : Less than 1.0 EU per μg by the LAL method
Purity : >85% as determined by reduced SDS-PAGE
Storage : Store it under sterile conditions at -20ºC to -80ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.45mg/ml. Centrifuge the vial at 4ºC before opening to recover the entire contents.
Gene Name DSCAM DS cell adhesion molecule [ Homo sapiens ]
Official Symbol DSCAM
Synonyms CHD2; CHD2-42; CHD2-52
Gene ID 1826
mRNA Refseq NM_001389
Protein Refseq NP_001380
MIM 602523
UniProt ID O60469

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DSCAM Products

Required fields are marked with *

My Review for All DSCAM Products

Required fields are marked with *

0
cart-icon
0
compare icon