Recombinant Human DSCAM, His-tagged
| Cat.No. : | DSCAM-12170H |
| Product Overview : | Recombinant Human DSCAM Protein is produced by E. coli expression system. The target protein is expressed with sequence Gly1913-Glu2012 of human DSCAM (Accession #NP_001380), fused with a His tag at the N-terminus. |
| Availability | August 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 1913-2012 aa |
| Form : | Lyophilized from sterile PBS, pH7.5, 0.5% SKL, 5% Trehalose, 5% Mannitol. |
| Molecular Mass : | 15 kDa |
| AASequence : | MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSRGGPGTSRDLSLGQACLEPQKSRTLKRPTVLEPIPMEAASSASSTREGQSWQPGAVATLPQREGAELGQAAKMSSSQESLLDSRGHLKGNNPYAKSYTLV |
| Endotoxin : | Less than 1.0 EU per μg by the LAL method |
| Purity : | >85% as determined by reduced SDS-PAGE |
| Storage : | Store it under sterile conditions at -20ºC to -80ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.45mg/ml. Centrifuge the vial at 4ºC before opening to recover the entire contents. |
| Gene Name | DSCAM DS cell adhesion molecule [ Homo sapiens ] |
| Official Symbol | DSCAM |
| Synonyms | CHD2; CHD2-42; CHD2-52 |
| Gene ID | 1826 |
| mRNA Refseq | NM_001389 |
| Protein Refseq | NP_001380 |
| MIM | 602523 |
| UniProt ID | O60469 |
| ◆ Recombinant Proteins | ||
| DSCAM-2535M | Recombinant Mouse DSCAM Protein, His (Fc)-Avi-tagged | +Inquiry |
| DSCAM-12170H | Recombinant Human DSCAM, His-tagged | +Inquiry |
| DSCAM-1000H | Active Recombinant Human DSCAM | +Inquiry |
| DSCAM-4388H | Recombinant Human DSCAM Protein, His (Fc)-Avi-tagged | +Inquiry |
| DSCAM-1961R | Recombinant Rat DSCAM Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSCAM Products
Required fields are marked with *
My Review for All DSCAM Products
Required fields are marked with *



