Recombinant Human DSCR9 Protein, GST-tagged

Cat.No. : DSCR9-2887H
Product Overview : Human DSCR9 full-length ORF ( NP_683516.1, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DSCR9 (Down Syndrome Critical Region 9 (Non-Protein Coding)) is an RNA Gene, and is affiliated with the non-coding RNA class. Diseases associated with DSCR9 include Down Syndrome.
Molecular Mass : 43.1 kDa
AA Sequence : MGRICPVNSRARRLRARPGRPSGDSLPYHQLQGGAPRLWSPDPGRPAAYRRAHVCDVTAPRWGSTSRQGEGAVLQRMLGRRAPPSWSRDHAYSRRGWENAALFLNRKRKQEGTENTSICCRPESALACGGNLSPQFLKKVIQIQTQELW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DSCR9 Down syndrome critical region gene 9 (non-protein coding) [ Homo sapiens (human) ]
Official Symbol DSCR9
Synonyms NCRNA00038; Down syndrome critical region gene 9 (non-protein coding); DSCR9
Gene ID 257203
UniProt ID P59020

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DSCR9 Products

Required fields are marked with *

My Review for All DSCR9 Products

Required fields are marked with *

0
cart-icon