Recombinant Human DSG1 protein(391-540 aa), C-His-tagged
| Cat.No. : | DSG1-2820H | 
| Product Overview : | Recombinant Human DSG1 protein(Q02413)(391-540 aa), fused with C-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 391-540 aa | 
| Form : | 0.15 M Phosphate buffered saline | 
| Molecular Mass : | 18.5 kDa | 
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. | 
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| AA Sequence : | TYVVTGNMGSNDKVGDFVATDLDTGRPSTTVRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTININIQSFGNDDRTNTEPNTKITTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLL | 
| Gene Name | DSG1 desmoglein 1 [ Homo sapiens ] | 
| Official Symbol | DSG1 | 
| Synonyms | DSG1; desmoglein 1; DSG; desmoglein-1; CDHF4; DGI; cadherin family member 4; desmosomal glycoprotein 1; pemphigus foliaceus antigen; DG1; PPKS1; SPPK1; | 
| Gene ID | 1828 | 
| mRNA Refseq | NM_001942 | 
| Protein Refseq | NP_001933 | 
| MIM | 125670 | 
| UniProt ID | Q02413 | 
| ◆ Recombinant Proteins | ||
| DSG1-26581TH | Recombinant Human DSG1 | +Inquiry | 
| DSG1-1388H | Recombinant Human DSG1 Protein, His-tagged | +Inquiry | 
| DSG1-4254HF | Recombinant Full Length Human DSG1 Protein, GST-tagged | +Inquiry | 
| DSG1-0269H | Recombinant Human DSG1 Protein, Tag Free | +Inquiry | 
| DSG1-1601H | Recombinant Human Desmoglein 1 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DSG1-512HCL | Recombinant Human DSG1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSG1 Products
Required fields are marked with *
My Review for All DSG1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            