Recombinant Human DSG1 protein(391-540 aa), C-His-tagged
Cat.No. : | DSG1-2820H |
Product Overview : | Recombinant Human DSG1 protein(Q02413)(391-540 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 391-540 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 18.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | TYVVTGNMGSNDKVGDFVATDLDTGRPSTTVRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTININIQSFGNDDRTNTEPNTKITTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLL |
Gene Name | DSG1 desmoglein 1 [ Homo sapiens ] |
Official Symbol | DSG1 |
Synonyms | DSG1; desmoglein 1; DSG; desmoglein-1; CDHF4; DGI; cadherin family member 4; desmosomal glycoprotein 1; pemphigus foliaceus antigen; DG1; PPKS1; SPPK1; |
Gene ID | 1828 |
mRNA Refseq | NM_001942 |
Protein Refseq | NP_001933 |
MIM | 125670 |
UniProt ID | Q02413 |
◆ Recombinant Proteins | ||
DSG1-2458H | Recombinant Human DSG1 protein, His-SUMO & Myc-tagged | +Inquiry |
DSG1-1794H | Recombinant Human DSG1 protein(50-609aa), His-tagged | +Inquiry |
DSG1-4389H | Recombinant Human DSG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DSG1-1601H | Recombinant Human Desmoglein 1 | +Inquiry |
DSG1-12178H | Recombinant Human DSG1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DSG1-512HCL | Recombinant Human DSG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DSG1 Products
Required fields are marked with *
My Review for All DSG1 Products
Required fields are marked with *
0
Inquiry Basket