Recombinant Human DSG1 protein(391-540 aa), C-His-tagged
| Cat.No. : | DSG1-2820H |
| Product Overview : | Recombinant Human DSG1 protein(Q02413)(391-540 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 391-540 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 18.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | TYVVTGNMGSNDKVGDFVATDLDTGRPSTTVRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTININIQSFGNDDRTNTEPNTKITTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLL |
| Gene Name | DSG1 desmoglein 1 [ Homo sapiens ] |
| Official Symbol | DSG1 |
| Synonyms | DSG1; desmoglein 1; DSG; desmoglein-1; CDHF4; DGI; cadherin family member 4; desmosomal glycoprotein 1; pemphigus foliaceus antigen; DG1; PPKS1; SPPK1; |
| Gene ID | 1828 |
| mRNA Refseq | NM_001942 |
| Protein Refseq | NP_001933 |
| MIM | 125670 |
| UniProt ID | Q02413 |
| ◆ Recombinant Proteins | ||
| DSG1-4066H | Recombinant Human DSG1 Protein (Glu50-Pro548), C-His tagged | +Inquiry |
| DSG1-12178H | Recombinant Human DSG1 protein, His-tagged | +Inquiry |
| DSG1-1601H | Recombinant Human Desmoglein 1 | +Inquiry |
| DSG1-4067H | Recombinant Human DSG1 Protein (Glu50-Pro548), C-His tagged | +Inquiry |
| DSG1-0269H | Recombinant Human DSG1 Protein, Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DSG1-512HCL | Recombinant Human DSG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSG1 Products
Required fields are marked with *
My Review for All DSG1 Products
Required fields are marked with *
