Recombinant Human DSG3 protein, His-SUMO-tagged
Cat.No. : | DSG3-2826H |
Product Overview : | Recombinant Human DSG3 protein(P32926)(70-499aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 70-499aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 64 kDa |
AA Sequence : | IAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREETPSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILNATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGADKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSSELLRFQVTDLDEEYTDNWLAVYFFTSGNEGNWFEIQTDPRTNEGILKVVKALDYEQLQSVKLSIAVKNKAEFHQSVISRYRVQSTPVTIQVINVREGIAFRPASKTFTVQKGISSKKLVDYILGTYQAIDEDTNKAASNVKYVMGRNDGGYLMIDSKTAEIKFVKNMNRDSTFIVNKTITAEVLAIDEYTGKTSTGTVYVRVPDFNDNCPTAVLEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | DSG3 desmoglein 3 [ Homo sapiens ] |
Official Symbol | DSG3 |
Synonyms | DSG3; desmoglein 3; desmoglein 3 (pemphigus vulgaris antigen); desmoglein-3; CDHF6; pemphigus vulgaris antigen; cadherin family member 6; 130-kD pemphigus vulgaris antigen; 130 kDa pemphigus vulgaris antigen; PVA; DKFZp686P23184; |
Gene ID | 1830 |
mRNA Refseq | NM_001944 |
Protein Refseq | NP_001935 |
MIM | 169615 |
UniProt ID | P32926 |
◆ Recombinant Proteins | ||
DSG3-5905H | Recombinant Human DSG3 protein, His&Myc-tagged | +Inquiry |
DSG3-2827H | Recombinant Human DSG3 protein, His-tagged | +Inquiry |
Dsg3-4632M | Recombinant Mouse Dsg3 protein, His-tagged | +Inquiry |
DSG3-1389H | Recombinant Human DSG3 Protein, His-tagged | +Inquiry |
DSG3-4069H | Recombinant Human DSG3 Protein (Glu50-Arg615), C-Fc tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSG3 Products
Required fields are marked with *
My Review for All DSG3 Products
Required fields are marked with *