Recombinant Human DSTN, His-tagged
Cat.No. : | DSTN-26582TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-165 of Human Destrin with an N terminal His tag. Predicted MWt: 20 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-165 a.a. |
Description : | The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene. |
Conjugation : | HIS |
Tissue specificity : | Widely distributed in various tissues. |
Form : | Lyophilised:Reconstitute with 102 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCL SADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEK DCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMI YASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGG SLIVAFEGCPV |
Sequence Similarities : | Belongs to the actin-binding proteins ADF family.Contains 1 ADF-H domain. |
Full Length : | Full L. |
Gene Name | DSTN destrin (actin depolymerizing factor) [ Homo sapiens ] |
Official Symbol | DSTN |
Synonyms | DSTN; destrin (actin depolymerizing factor); destrin; ACTDP; ADF; |
Gene ID | 11034 |
mRNA Refseq | NM_006870 |
Protein Refseq | NP_006861 |
MIM | 609114 |
Uniprot ID | P60981 |
Chromosome Location | 20p12.1 |
Function | actin binding; |
◆ Recombinant Proteins | ||
DSTN-1337R | Recombinant Rhesus monkey DSTN Protein, His-tagged | +Inquiry |
DSTN-7076C | Recombinant Chicken DSTN | +Inquiry |
DSTN-4056HF | Recombinant Full Length Human DSTN Protein, GST-tagged | +Inquiry |
DSTN-1622R | Recombinant Rat DSTN Protein, His (Fc)-Avi-tagged | +Inquiry |
Dstn-2665M | Recombinant Mouse Dstn Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DSTN-6805HCL | Recombinant Human DSTN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSTN Products
Required fields are marked with *
My Review for All DSTN Products
Required fields are marked with *