Recombinant Human DSTN Protein, GST-tagged

Cat.No. : DSTN-2894H
Product Overview : Human DSTN full-length ORF ( AAH09477.1, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 44.9 kDa
AA Sequence : MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DSTN destrin (actin depolymerizing factor) [ Homo sapiens ]
Official Symbol DSTN
Synonyms DSTN; destrin (actin depolymerizing factor); destrin; ACTDP; ADF; actin-depolymerizing factor; bA462D18.2 (destrin (actin depolymerizing factor ADF) (ACTDP)); bA462D18.2;
Gene ID 11034
mRNA Refseq NM_001011546
Protein Refseq NP_001011546
MIM 609114
UniProt ID P60981

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DSTN Products

Required fields are marked with *

My Review for All DSTN Products

Required fields are marked with *

0
cart-icon
0
compare icon