Recombinant Human DSTN Protein, GST-tagged
Cat.No. : | DSTN-2894H |
Product Overview : | Human DSTN full-length ORF ( AAH09477.1, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DSTN destrin (actin depolymerizing factor) [ Homo sapiens ] |
Official Symbol | DSTN |
Synonyms | DSTN; destrin (actin depolymerizing factor); destrin; ACTDP; ADF; actin-depolymerizing factor; bA462D18.2 (destrin (actin depolymerizing factor ADF) (ACTDP)); bA462D18.2; |
Gene ID | 11034 |
mRNA Refseq | NM_001011546 |
Protein Refseq | NP_001011546 |
MIM | 609114 |
UniProt ID | P60981 |
◆ Recombinant Proteins | ||
DSTN-30180H | Recombinant Human DSTN protein, GST-tagged | +Inquiry |
DSTN-1337R | Recombinant Rhesus monkey DSTN Protein, His-tagged | +Inquiry |
DSTN-1638H | Recombinant Human DSTN protein, His & GST-tagged | +Inquiry |
DSTN-1622R | Recombinant Rat DSTN Protein, His (Fc)-Avi-tagged | +Inquiry |
DSTN-1963R | Recombinant Rat DSTN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DSTN-6805HCL | Recombinant Human DSTN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSTN Products
Required fields are marked with *
My Review for All DSTN Products
Required fields are marked with *