Recombinant Human DTNB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DTNB-1146H |
Product Overview : | DTNB MS Standard C13 and N15-labeled recombinant protein (NP_899205) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes dystrobrevin beta, a component of the dystrophin-associated protein complex (DPC). The DPC consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and dystrobrevin alpha and beta. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Dystrobrevin beta is thought to interact with syntrophin and the DP71 short form of dystrophin. |
Molecular Mass : | 63.8 kDa |
AA Sequence : | MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLPSTHQISVEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEHSSWKSPAKKLSHAISKSLGCVPTREPPHPVFPEQPEKPLDLAHIVPPRPLTNMNDTMVSHMSSGVPTPTKSVLDSPSRLDEEHRLIARYAARLAAEAGNVTRPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHCPQDSLSGVGGDVQEAFAQAEEGAEEEEEKMQNGKDRGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DTNB dystrobrevin beta [ Homo sapiens (human) ] |
Official Symbol | DTNB |
Synonyms | DTNB; dystrobrevin, beta; dystrobrevin beta; DTN-B; beta-dystrobrevin; MGC17163; MGC57126; |
Gene ID | 1838 |
mRNA Refseq | NM_183361 |
Protein Refseq | NP_899205 |
MIM | 602415 |
UniProt ID | O60941 |
◆ Recombinant Proteins | ||
DTNB-2900H | Recombinant Human DTNB Protein, GST-tagged | +Inquiry |
Dtnb-2671M | Recombinant Mouse Dtnb Protein, Myc/DDK-tagged | +Inquiry |
DTNB-4061HF | Recombinant Full Length Human DTNB Protein, GST-tagged | +Inquiry |
DTNB-1965R | Recombinant Rat DTNB Protein | +Inquiry |
DTNB-4852M | Recombinant Mouse DTNB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DTNB-6798HCL | Recombinant Human DTNB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DTNB Products
Required fields are marked with *
My Review for All DTNB Products
Required fields are marked with *
0
Inquiry Basket