Recombinant Human DTNBP1, His-tagged
| Cat.No. : | DTNBP1-26932TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-351 of Human Dysbindin with an N terminal His tag. Predicted mwt: 40 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-351 a.a. |
| Description : | This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations in this gene are associated with Hermansky-Pudlak syndrome type 7. This gene may also be associated with schizophrenia. Multiple transcript variants encoding distinct isoforms have been identified for this gene. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitution with 85 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVP FLPKYSAGLELLSRYEDTWAALHRRAKDCASAGELVDS EVVMLSAHWEKKKTSLVELQEQLQQLPALIADLESMTA NLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQ LENYKKNKRKELETFKAELDAEHAQKVLEMEHTQQMKLKE RQKFFEEAFQQDMEQYLSTGYLQIAERREPIGSMSSME VNVDMLEQMDLMDISDQEALDVFLNSGGEENTVLSPAL GPESSTCQNEITLQVPNPSELRAKPPSSSSTCTDSATR DISEGGESPVVQSDEEEVQVDTALATSHTDREATPDGG EDSDS |
| Full Length : | Full L. |
| Gene Name | DTNBP1 dystrobrevin binding protein 1 [ Homo sapiens ] |
| Official Symbol | DTNBP1 |
| Synonyms | DTNBP1; dystrobrevin binding protein 1; dysbindin; DBND; Dysbindin; HPS7; My031; |
| Gene ID | 84062 |
| mRNA Refseq | NM_032122 |
| Protein Refseq | NP_115498 |
| MIM | 607145 |
| Uniprot ID | Q96EV8 |
| Chromosome Location | 6p22.3 |
| Pathway | Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem; |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| DTNBP1-26457TH | Recombinant Human DTNBP1, His-tagged | +Inquiry |
| DTNBP1-2303H | Recombinant Human DTNBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DTNBP1-4853M | Recombinant Mouse DTNBP1 Protein | +Inquiry |
| DTNBP1-1515C | Recombinant Chicken DTNBP1 | +Inquiry |
| DTNBP1-2233H | Recombinant Human DTNBP1 Protein (Gln100-Ser351), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DTNBP1-6796HCL | Recombinant Human DTNBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DTNBP1 Products
Required fields are marked with *
My Review for All DTNBP1 Products
Required fields are marked with *
