Recombinant Human DTWD1 Protein (1-109 aa), GST-tagged
| Cat.No. : | DTWD1-462H |
| Product Overview : | Recombinant Human DTWD1 Protein (1-109 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-109 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 39.2 kDa |
| AA Sequence : | MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAI |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | DTWD1 DTW domain containing 1 [ Homo sapiens (human) ] |
| Official Symbol | DTWD1 |
| Synonyms | MDS009; |
| Gene ID | 56986 |
| mRNA Refseq | NM_001144955 |
| Protein Refseq | NP_001138427 |
| UniProt ID | Q8N5C7 |
| ◆ Recombinant Proteins | ||
| DTWD1-2904H | Recombinant Human DTWD1 Protein, GST-tagged | +Inquiry |
| DTWD1-4065HF | Recombinant Full Length Human DTWD1 Protein, GST-tagged | +Inquiry |
| DTWD1-2715H | Recombinant Human DTWD1 Protein, His-tagged | +Inquiry |
| DTWD1-1342R | Recombinant Rhesus monkey DTWD1 Protein, His-tagged | +Inquiry |
| DTWD1-2868H | Recombinant Human DTWD1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DTWD1-6795HCL | Recombinant Human DTWD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DTWD1 Products
Required fields are marked with *
My Review for All DTWD1 Products
Required fields are marked with *
