Recombinant Human DTWD1 Protein, GST-tagged
Cat.No. : | DTWD1-2904H |
Product Overview : | Human DTWD1 full-length ORF ( NP_064619.2, 1 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DTWD1 (DTW Domain Containing 1) is a Protein Coding gene. |
Molecular Mass : | 61.6 kDa |
AA Sequence : | MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAIHAKLLAPEFVNIYTYPCIPEYEEKDHEVALIFPGPQSISIKDISFHLQKRIQNNVRGKNDDPDKPSFKRKRTEEQEFCDLNDSKCKGTTLKKIIFIDSTWNQTNKIFTDERLQGLLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTDILKEKYRGQYDNLLFFYSFMYQLIKNAKCSGDKETGKLTH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DTWD1 DTW domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | DTWD1 |
Synonyms | DTWD1; DTW domain containing 1; DTW Domain Containing 1; DTW Domain-Containing Protein 1; X 009 Protein; MDS009; DTW domain-containing protein 1; x 009 protein |
Gene ID | 56986 |
mRNA Refseq | NM_001144955 |
Protein Refseq | NP_001138427 |
UniProt ID | Q8N5C7 |
◆ Recombinant Proteins | ||
DTWD1-1481Z | Recombinant Zebrafish DTWD1 | +Inquiry |
DTWD1-2904H | Recombinant Human DTWD1 Protein, GST-tagged | +Inquiry |
DTWD1-4065HF | Recombinant Full Length Human DTWD1 Protein, GST-tagged | +Inquiry |
DTWD1-1626R | Recombinant Rat DTWD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DTWD1-4854M | Recombinant Mouse DTWD1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DTWD1-6795HCL | Recombinant Human DTWD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DTWD1 Products
Required fields are marked with *
My Review for All DTWD1 Products
Required fields are marked with *
0
Inquiry Basket