Recombinant Human DTWD1 Protein, GST-tagged

Cat.No. : DTWD1-2904H
Product Overview : Human DTWD1 full-length ORF ( NP_064619.2, 1 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DTWD1 (DTW Domain Containing 1) is a Protein Coding gene.
Molecular Mass : 61.6 kDa
AA Sequence : MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAIHAKLLAPEFVNIYTYPCIPEYEEKDHEVALIFPGPQSISIKDISFHLQKRIQNNVRGKNDDPDKPSFKRKRTEEQEFCDLNDSKCKGTTLKKIIFIDSTWNQTNKIFTDERLQGLLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTDILKEKYRGQYDNLLFFYSFMYQLIKNAKCSGDKETGKLTH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DTWD1 DTW domain containing 1 [ Homo sapiens (human) ]
Official Symbol DTWD1
Synonyms DTWD1; DTW domain containing 1; DTW Domain Containing 1; DTW Domain-Containing Protein 1; X 009 Protein; MDS009; DTW domain-containing protein 1; x 009 protein
Gene ID 56986
mRNA Refseq NM_001144955
Protein Refseq NP_001138427
UniProt ID Q8N5C7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DTWD1 Products

Required fields are marked with *

My Review for All DTWD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon