Recombinant Human DULLARD Protein, GST-tagged
| Cat.No. : | DULLARD-2914H |
| Product Overview : | Human DULLARD full-length ORF ( NP_056158.2, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CTDNEP1 (CTD Nuclear Envelope Phosphatase 1) is a Protein Coding gene. Among its related pathways are Mitotic Prophase and Transport of the SLBP independent Mature mRNA. GO annotations related to this gene include phosphatase activity and protein serine/threonine phosphatase activity. |
| Molecular Mass : | 54.8 kDa |
| AA Sequence : | MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CTDNEP1 CTD nuclear envelope phosphatase 1 [ Homo sapiens (human) ] |
| Official Symbol | DULLARD |
| Synonyms | CTDNEP1; CTD nuclear envelope phosphatase 1; CTD Nuclear Envelope Phosphatase 1; C-Terminal Domain Nuclear Envelope Phosphatase 1; Serine/Threonine-Protein Phosphatase Dullard; DULLARD; Dullard Homolog (Xenopus Laevis); Dullard Homolog; EC 3.1.3.16; HSA011916; NET56; CTD nuclear envelope phosphatase 1; C-terminal domain nuclear envelope phosphatase 1; dullard homolog; serine/threonine-protein phosphatase dullard; EC 3.1.3.16 |
| Gene ID | 23399 |
| mRNA Refseq | NM_001143775 |
| Protein Refseq | NP_001137247 |
| MIM | 610684 |
| UniProt ID | O95476 |
| ◆ Recombinant Proteins | ||
| DULLARD-4082HF | Recombinant Full Length Human DULLARD Protein, GST-tagged | +Inquiry |
| DULLARD-2914H | Recombinant Human DULLARD Protein, GST-tagged | +Inquiry |
| DULLARD-12196H | Recombinant Human DULLARD, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DULLARD-6790HCL | Recombinant Human DULLARD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DULLARD Products
Required fields are marked with *
My Review for All DULLARD Products
Required fields are marked with *
