Recombinant Human DUSP13 protein, His-SUMO-tagged

• Cat.No.: DUSP13-4541H
• Product Overview: Recombinant Human DUSP13 protein(Q6B8I1)(1-198aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-198aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.7 kDa
• AA Sequence: MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNAAHKGLYCQGGPDFYGSSVSYLGVPAHDLPDFDISAYFSSAADFIHRALNTPGAKVLVHCVVGVSRSATLVLAYLMLHQRLSLRQAVITVRQHRWVFPNRGFLHQLCRLDQQLRGAGQS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: DUSP13 dual specificity phosphatase 13 [ Homo sapiens ]
• Official Symbol: DUSP13
• Synonyms: DUSP13; dual specificity phosphatase 13; dual specificity protein phosphatase 13; BEDP; DUSP13A; DUSP13B; FLJ32450; TMDP; muscle-restricted DSP; branching-enzyme interacting DSP; dual specificity phosphatase SKRP4; testis- and skeletal-muscle-specific DSP; branching-enzyme interacting dual-specificity protein phosphatase; MDSP; SKRP4
• Gene ID: 51207
• mRNA Refseq: NM_001007271
• Protein Refseq: NP_001007272
• MIM: 613191
• UniProt ID: Q6B8I1