Recombinant Human DUSP18 Protein, GST-tagged
Cat.No. : | DUSP18-2931H |
Product Overview : | Human DUSP18 full-length ORF ( NP_689724.3, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP18 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009] |
Molecular Mass : | 47.5 kDa |
AA Sequence : | MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DUSP18 dual specificity phosphatase 18 [ Homo sapiens ] |
Official Symbol | DUSP18 |
Synonyms | DUSP18; dual specificity phosphatase 18; dual specificity protein phosphatase 18; DUSP20; LMW-DSP20; low molecular weight dual specificity phosphatase 20; DSP18; LMWDSP20; bK963H5.1; MGC32658; |
Gene ID | 150290 |
mRNA Refseq | NM_152511 |
Protein Refseq | NP_689724 |
MIM | 611446 |
UniProt ID | Q8NEJ0 |
◆ Recombinant Proteins | ||
DUSP18-1974R | Recombinant Rat DUSP18 Protein | +Inquiry |
DUSP18-3932H | Recombinant Human DUSP18 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DUSP18-1350R | Recombinant Rhesus monkey DUSP18 Protein, His-tagged | +Inquiry |
DUSP18-1633R | Recombinant Rat DUSP18 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP18-12210H | Recombinant Human DUSP18, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP18-6780HCL | Recombinant Human DUSP18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP18 Products
Required fields are marked with *
My Review for All DUSP18 Products
Required fields are marked with *