Recombinant Human DUSP21 Protein, GST-tagged

Cat.No. : DUSP21-2933H
Product Overview : Human DUSP21 full-length ORF ( NP_071359.2, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the dual specificity phosphatase family, specifically the low molecular weight dual specificity phosphatase family. The encoded protein localizes to both the cytoplasm and the nucleus and functions to remove phosphate groups from phosphotyrosine and phosphothreonine residues.[provided by RefSeq, Mar 2009]
Molecular Mass : 47.9 kDa
AA Sequence : MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVNVFFEGIQYIKVPVTDARDSRLYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAYLMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIYEKDLRTMISM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DUSP21 dual specificity phosphatase 21 [ Homo sapiens ]
Official Symbol DUSP21
Synonyms DUSP21; dual specificity phosphatase 21; dual specificity protein phosphatase 21; LMW-DSP21; BJ-HCC-26 tumor antigen; low molecular weight dual specificity phosphatase 21; LMWDSP21; MGC149878;
Gene ID 63904
mRNA Refseq NM_022076
Protein Refseq NP_071359
MIM 300678
UniProt ID Q9H596

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUSP21 Products

Required fields are marked with *

My Review for All DUSP21 Products

Required fields are marked with *

0
cart-icon
0
compare icon