Recombinant Human DUSP21 Protein, GST-tagged
Cat.No. : | DUSP21-2933H |
Product Overview : | Human DUSP21 full-length ORF ( NP_071359.2, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the dual specificity phosphatase family, specifically the low molecular weight dual specificity phosphatase family. The encoded protein localizes to both the cytoplasm and the nucleus and functions to remove phosphate groups from phosphotyrosine and phosphothreonine residues.[provided by RefSeq, Mar 2009] |
Molecular Mass : | 47.9 kDa |
AA Sequence : | MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVNVFFEGIQYIKVPVTDARDSRLYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAYLMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIYEKDLRTMISM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DUSP21 dual specificity phosphatase 21 [ Homo sapiens ] |
Official Symbol | DUSP21 |
Synonyms | DUSP21; dual specificity phosphatase 21; dual specificity protein phosphatase 21; LMW-DSP21; BJ-HCC-26 tumor antigen; low molecular weight dual specificity phosphatase 21; LMWDSP21; MGC149878; |
Gene ID | 63904 |
mRNA Refseq | NM_022076 |
Protein Refseq | NP_071359 |
MIM | 300678 |
UniProt ID | Q9H596 |
◆ Recombinant Proteins | ||
DUSP21-428H | Recombinant Human DUSP21 | +Inquiry |
DUSP21-2933H | Recombinant Human DUSP21 Protein, GST-tagged | +Inquiry |
DUSP21-12212H | Recombinant Human DUSP21, His-tagged | +Inquiry |
DUSP21-4101HF | Recombinant Full Length Human DUSP21 Protein, GST-tagged | +Inquiry |
DUSP21-1177R | Recombinant Rhesus Macaque DUSP21 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP21-6778HCL | Recombinant Human DUSP21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP21 Products
Required fields are marked with *
My Review for All DUSP21 Products
Required fields are marked with *