Recombinant Human DUSP22 Protein, GST-tagged
Cat.No. : | DUSP22-2934H |
Product Overview : | Human DUSP22 full-length ORF ( NP_064570.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DUSP22 (Dual Specificity Phosphatase 22) is a Protein Coding gene. Diseases associated with DUSP22 include Alk-Negative Anaplastic Large Cell Lymphoma and Lymphatic System Cancer. GO annotations related to this gene include phosphatase activity and protein tyrosine/serine/threonine phosphatase activity. An important paralog of this gene is DUSP15. |
Molecular Mass : | 47.3 kDa |
AA Sequence : | MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DUSP22 dual specificity phosphatase 22 [ Homo sapiens ] |
Official Symbol | DUSP22 |
Synonyms | DUSP22; dual specificity phosphatase 22; dual specificity protein phosphatase 22; JKAP; JSP1; MKPX; VHX; JSP-1; MKP-x; LMW-DSP2; MAP kinase phosphatase x; JNK-stimulating phosphatase 1; JNK-stimulatory phosphatase-1; mitogen-activated protein kinase phosphatase x; low molecular weight dual specificity phosphatase 2; homolog of mouse dual specificity phosphatase LMW-DSP2; LMWDSP2; FLJ35864; |
Gene ID | 56940 |
mRNA Refseq | NM_020185 |
Protein Refseq | NP_064570 |
MIM | 616778 |
UniProt ID | Q9NRW4 |
◆ Recombinant Proteins | ||
DUSP22-2567M | Recombinant Mouse DUSP22 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP22-2934H | Recombinant Human DUSP22 Protein, GST-tagged | +Inquiry |
DUSP22-459H | Recombinant Human Dual Specificity Phosphatase 22, GST-tagged, Active | +Inquiry |
DUSP22-4884M | Recombinant Mouse DUSP22 Protein | +Inquiry |
DUSP22-191H | Recombinant Human DUSP22, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP22-6777HCL | Recombinant Human DUSP22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUSP22 Products
Required fields are marked with *
My Review for All DUSP22 Products
Required fields are marked with *
0
Inquiry Basket